DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GSKIP and CG11523

DIOPT Version :10

Sequence 1:NP_057556.2 Gene:GSKIP / 51527 HGNCID:20343 Length:139 Species:Homo sapiens
Sequence 2:NP_649386.1 Gene:CG11523 / 40458 FlyBaseID:FBgn0037156 Length:158 Species:Drosophila melanogaster


Alignment Length:116 Identity:38/116 - (32%)
Similarity:58/116 - (50%) Gaps:16/116 - (13%)


- Green bases have known domain annotations that are detailed below.


Human    36 EAEAVVNDVLFAVNNMFVSKSLRCADDVAYINVETKERNRYCLELTEAGLKVVGYAFDQVD---- 96
            ||.|::|||...|..:.:|..|.......|:|:.|.|....|::::..|.|:|...:|.:|    
  Fly    21 EANAIINDVKAHVAEICISSKLASDATQIYLNIRTIESATCCVQVSSRGFKIVSSQYDTIDEDSR 85

Human    97 ------------DHLQTPYHETVYSLLDTLSPAYREAFGNALLQRLEALKR 135
                        |..:....||.|:|||.:||.|.|:|||.|.|:|.||::
  Fly    86 ISALLRNGQEQGDDEEEEIFETPYALLDKISPRYVESFGNQLCQQLRALQQ 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GSKIPNP_057556.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22
GSKIP_dom 33..133 CDD:398795 36/112 (32%)
Required for PRKAR2A interaction, contributes to a protective effect against H(2)O(2)-induced apoptosis. /evidence=ECO:0000269|PubMed:25920809 41..45 2/3 (67%)
Interaction with GSK3B and acts as a GSK3B inhibitor. /evidence=ECO:0000269|PubMed:16981698 115..139 12/21 (57%)
CG11523NP_649386.1 GSKIP_dom 18..134 CDD:398795 36/112 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.