DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GSKIP and CG14505

DIOPT Version :10

Sequence 1:NP_057556.2 Gene:GSKIP / 51527 HGNCID:20343 Length:139 Species:Homo sapiens
Sequence 2:NP_001036558.1 Gene:CG14505 / 37098 FlyBaseID:FBgn0034327 Length:119 Species:Drosophila melanogaster


Alignment Length:91 Identity:33/91 - (36%)
Similarity:53/91 - (58%) Gaps:4/91 - (4%)


- Green bases have known domain annotations that are detailed below.


Human    36 EAEAVVNDVLFAVNNMFVSKSLRCADDVAYINVETKERNRYCLELTEAGLKVVGYAFDQVDDHL- 99
            ||:.:|:......:::.|::.|.....|||||:.|.|:..||::|:.||.::|.|.||.|.|.: 
  Fly    16 EAQRMVDSCQDFADHLIVAEFLPHCRGVAYINIRTLEQVIYCVQLSRAGYRIVSYEFDDVADEVA 80

Human   100 --QTPYHETVYSLLDTLSPAYREAFG 123
              .|.| |:.:.||..:||.|.|.:|
  Fly    81 NCDTVY-ESAHQLLAGISPLYGEKYG 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GSKIPNP_057556.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22
GSKIP_dom 33..133 CDD:398795 33/91 (36%)
Required for PRKAR2A interaction, contributes to a protective effect against H(2)O(2)-induced apoptosis. /evidence=ECO:0000269|PubMed:25920809 41..45 1/3 (33%)
Interaction with GSK3B and acts as a GSK3B inhibitor. /evidence=ECO:0000269|PubMed:16981698 115..139 5/9 (56%)
CG14505NP_001036558.1 GSKIP_dom 15..116 CDD:398795 33/91 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.