DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TMEM14C and CG5532

DIOPT Version :10

Sequence 1:NP_057546.1 Gene:TMEM14C / 51522 HGNCID:20952 Length:112 Species:Homo sapiens
Sequence 2:NP_611826.1 Gene:CG5532 / 37761 FlyBaseID:FBgn0034902 Length:112 Species:Drosophila melanogaster


Alignment Length:208 Identity:38/208 - (18%)
Similarity:75/208 - (36%) Gaps:57/208 - (27%)


- Green bases have known domain annotations that are detailed below.


Human   108 KENDLFDNYMQQDAHEFLNYLLNTIADILQEEKKQEKQNGKLKNGNMNEPAENNKPELTWVH--- 169
            |:..||...:.:.|:: .|:......|::.:.|.:.    .|...||:       |.|:..|   
  Fly   349 KKEPLFTGLLSRYAYK-RNFFEMMRFDLVVDNKLKV----HLMEANMS-------PNLSSAHFKP 401

Human   170 --EIFQGTLTNETRCLNCETVSSKDEDFLDLSVDVEQNTSITHCLRDFSNTETLCSE-------- 224
              .:::..:.|..:.:.......:| .|....:|.|   ::...|::.:....||||        
  Fly   402 NRLLYEQVIYNLFQLVGVGASIQRD-SFRKQPLDTE---AMLTSLKNLATAANLCSELPCTESCA 462

Human   225 --QKYYCETCCSKQEAQKRMRVKKLPMILALHLKRFKYMEQLHRYTKLSYRVVFPLELRLFNTSS 287
              :...|.||..:|:.....|.               |.|.::|.   ..:.:||:      ..|
  Fly   463 PVECQLCSTCLEEQDIDDLQRA---------------YREHMNRG---DMKRIFPV------PKS 503

Human   288 DAVNLDRMYDLVA 300
            |...:|  |:|::
  Fly   504 DQHRVD--YELLS 514

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TMEM14CNP_057546.1 Tmemb_14 13..101 CDD:461004
CG5532NP_611826.1 Tmemb_14 6..94 CDD:461004
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.