DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DTL and cdt2

DIOPT Version :9

Sequence 1:NP_057532.4 Gene:DTL / 51514 HGNCID:30288 Length:730 Species:Homo sapiens
Sequence 2:NP_593588.1 Gene:cdt2 / 2542374 PomBaseID:SPAC17H9.19c Length:490 Species:Schizosaccharomyces pombe


Alignment Length:364 Identity:96/364 - (26%)
Similarity:163/364 - (44%) Gaps:57/364 - (15%)


- Green bases have known domain annotations that are detailed below.


Human    52 PFGCTFSSAPNMEHVLAVANEEGFVRLY--------NTESQSFRKKCFKEWMAHWNAVFDLAWVP 108
            ||...|:   |.|.:|||..|.|.:.|:        |.|:|...:: ...|:||.||:|.:.:..
pombe   130 PFCLGFA---NNESLLAVCTETGALELFDSRFYDRQNEENQPSARR-IHGWLAHNNAIFSVNFSK 190

Human   109 GELKLVTAAGDQTAKFWDVKAGELI------GTCKGHQCSLKSVAFSKFEKAVFCTGGRDGNIMV 167
            .:..|.|::||||:|.:|:...:.|      |....|..|:|.|.|.........:..|||:|:.
pombe   191 DDSLLATSSGDQTSKVFDLSTQQCITRLGRRGVDGYHSHSVKQVNFCNDSPYNLVSCSRDGSIIF 255

Human   168 WDTRCN--KKDG--FYRQVNQISGAHNTSDKQTPSKPKKKQNSKGLAPSVDFQQSVTVVLFQDEN 228
            ||.|.:  ..||  |.:.|.:|..||..|.:..                     |:|...:..::
pombe   256 WDMRTHGITIDGEHFQKPVLRIRKAHENSGRDC---------------------SITSATWLPQS 299

Human   229 T--LVSAGAVDGIIKVWDLRKNYTAYRQEPIASKSFLYPGSSTRKLGYSSLILDSTGSTLFANCT 291
            |  ::|:.:.:..:|:||||..:|. |..|.|:...|  .:|.|..|.:::.....|..::|...
pombe   300 TSQVISSCSANSALKLWDLRTVHTV-RPLPAATTPEL--TTSKRDFGVTNVCTSPDGERIYAASR 361

Human   292 DDNIYMFNMTGLKTSPVAIFNGH--QNSTFYVKSSLSPDDQFLVSG----SSDEAAYIWKVSTPW 350
            |..||.::...|.:.....:...  :.|:||||.:.|||...|..|    .......::..:...
pombe   362 DSIIYEYSSRHLNSGFCKTYKDPRLRISSFYVKLACSPDGATLACGGGVQDKTSGVVVFDTTRNC 426

Human   351 QPPTVLL-GHSQEVTSVCWCPSDFTKIATCSDDNTLKIW 388
            ....:|. ||:::||:|.|  |...::|:.|||.::::|
pombe   427 SSSAMLTGGHTKDVTAVDW--SSEGQLASISDDGSVRVW 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DTLNP_057532.4 WD 1 47..89 14/44 (32%)
WD40 55..389 CDD:238121 94/361 (26%)
WD40 repeat 55..96 CDD:293791 13/48 (27%)
WD 2 96..135 14/44 (32%)
WD40 repeat 101..137 CDD:293791 11/41 (27%)
WD 3 138..178 14/43 (33%)
WD40 repeat 144..197 CDD:293791 18/56 (32%)
DDB1-binding motif 168..171 2/2 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 188..210 3/21 (14%)
Nuclear localization signal. /evidence=ECO:0000255 197..203 0/5 (0%)
WD 4 214..253 10/40 (25%)
WD40 repeat 219..312 CDD:293791 22/94 (23%)
DDB1-binding motif 243..246 2/2 (100%)
WD40 repeat 264..304 CDD:293791 8/39 (21%)
WD 5 267..308 9/40 (23%)
WD 6 313..354 10/46 (22%)
WD40 repeat 320..356 CDD:293791 8/39 (21%)
WD 7 358..398 12/31 (39%)
WD40 repeat 363..388 CDD:293791 9/24 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 399..443
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 465..498
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 599..631
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 644..703
cdt2NP_593588.1 WD40 repeat 131..178 CDD:293791 14/50 (28%)
WD40 <132..208 CDD:295369 25/79 (32%)
WD40 <171..490 CDD:225201 82/320 (26%)
WD40 173..464 CDD:295369 82/317 (26%)
WD40 repeat 184..222 CDD:293791 10/37 (27%)
WD40 repeat 231..279 CDD:293791 15/47 (32%)
WD40 repeat 291..337 CDD:293791 13/48 (27%)
WD40 repeat 344..382 CDD:293791 6/37 (16%)
WD40 repeat 392..433 CDD:293791 8/40 (20%)
WD40 repeat 440..463 CDD:293791 9/24 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0321
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005579
OrthoInspector 1 1.000 - - oto146554
orthoMCL 1 0.900 - - OOG6_104235
Panther 1 1.100 - - LDO PTHR22852
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4627
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.840

Return to query results.
Submit another query.