DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PDE7A and Pde11

DIOPT Version :9

Sequence 1:NP_001229247.1 Gene:PDE7A / 5150 HGNCID:8791 Length:482 Species:Homo sapiens
Sequence 2:NP_001286044.1 Gene:Pde11 / 35107 FlyBaseID:FBgn0085370 Length:1451 Species:Drosophila melanogaster


Alignment Length:345 Identity:89/345 - (25%)
Similarity:161/345 - (46%) Gaps:31/345 - (8%)


- Green bases have known domain annotations that are detailed below.


Human   150 KVGNWNFDIFLFDRLTNGNSLVSLTFHLFSLHGLIEYFHLDMMKLRRFLVMIQEDYHSQNPYHNA 214
            ::.::.||...|:    .:..:.....:|.....:|.||:|...|.|:|:.::::|.:.. |||.
  Fly   803 RLHDFKFDDIHFE----DDDTLKACLRMFLDLDFVERFHIDYEVLCRWLLSVKKNYRNVT-YHNW 862

Human   215 VHAADVTQAMHCYLKEPKLANSVTPW-------DILLSLIAAATHDLDHPGVNQPFLIKTNHYLA 272
            .||.:|.|.|...|       :.|.|       :.|..:|....|||||.|.|..|.||.:..||
  Fly   863 RHAFNVAQMMFAIL-------TTTQWWKIFGEIECLALIIGCLCHDLDHRGTNNSFQIKASSPLA 920

Human   273 TLYKNTSVLENHHWRSAVGLLRESG--LFSHLPLESRQQMETQIGALILATDISRQNEYLSLFRS 335
            .|| :||.:|:||:...:.:|...|  :.::|..:...::...:...||:||::...:....|..
  Fly   921 QLY-STSTMEHHHFDQCLMILNSPGNQILANLSSDDYCRVIRVLEDAILSTDLAVYFKKRGPFLE 984

Human   336 HLDRGDLCLEDTRHRHLVLQMALKCADICNPCRTWELSKQWSEKVTEEFFHQGDIEKKYHLGVSP 400
            .:.:..........|.|:..|::...|:....:.||:.|:.::.|:.|||.|||:||: .|.::|
  Fly   985 SVSQPTSYWVAEEPRALLRAMSMTVCDLSAITKPWEIEKRVADLVSSEFFEQGDMEKQ-ELNITP 1048

Human   401 --LCDRHTE-SIANIQIGFMTYLVEPLFTEWARFSNTRLSQTMLGHVGLNKASWKGLQREQSSSE 462
              :.:|..| .:..:|:.|:..:..|::..:|..|: :|...:.| |..|:..|..|.....:..
  Fly  1049 IDIMNREKEDELPMMQVNFIDSICLPIYEAFATLSD-KLEPLVEG-VRDNRGHWIDLADVVKTKT 1111

Human   463 DTDAAFELNSQLLPQENRLS 482
            ..|...|...|   |:|.:|
  Fly  1112 SQDQEPEEEQQ---QQNVIS 1128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PDE7ANP_001229247.1 PDEase_I 211..444 CDD:395177 67/244 (27%)
Pde11NP_001286044.1 GAF 420..582 CDD:214500
GAF 611..762 CDD:214500
PDEase_I 859..1094 CDD:278654 67/245 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154156
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3689
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D904682at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.