DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HPCAL4 and CG7646

DIOPT Version :9

Sequence 1:NP_001269325.1 Gene:HPCAL4 / 51440 HGNCID:18212 Length:191 Species:Homo sapiens
Sequence 2:NP_001287124.1 Gene:CG7646 / 40187 FlyBaseID:FBgn0036926 Length:186 Species:Drosophila melanogaster


Alignment Length:187 Identity:81/187 - (43%)
Similarity:117/187 - (62%) Gaps:5/187 - (2%)


- Green bases have known domain annotations that are detailed below.


Human     1 MGKTNSK--LAPEVLEDLVQNTEFSEQELKQWYKGFLKDCPSGILNLEEFQQLYIKFFPYGDASK 63
            ||..:||  |..|.:|.|..:|.:.|..:|:|||||.:|||:|.|...:|..:|..|||.|:|.:
  Fly     1 MGCLSSKDRLTKEDMEFLKTHTRYDEATIKEWYKGFKQDCPNGRLTPAKFVDMYKMFFPSGNAEE 65

Human    64 FAQHAFRTFDKNGDGTIDFREFICALSVTSRGSFEQKLNWAFEMYDLDGDGRITRLEMLEIIEAI 128
            |..|.|||||.:.:|.|||:||:.|:.|||.|:.|:||.|||.|||:||:|.|...||.:|::||
  Fly    66 FCDHVFRTFDMDKNGYIDFKEFLLAIDVTSSGTPEEKLKWAFRMYDVDGNGVIDIQEMTKIVQAI 130

Human   129 YKMVGTVIMMRMNQDGLTPQQRVDKIFKKMDQDKDDQITLEEFKEAAKSDPSIVLLL 185
            |.|:|.   ...|:...:.::|...||.|||::.|.|:|.:||.:....|..:..:|
  Fly   131 YDMLGA---CSSNRPADSAEERAKNIFAKMDENNDGQLTQDEFLKGCLQDEELSKML 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HPCAL4NP_001269325.1 FRQ1 13..181 CDD:227455 74/167 (44%)
CG7646NP_001287124.1 FRQ1 18..178 CDD:227455 72/162 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143255
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1369072at2759
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.