DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HPCAL4 and CG2256

DIOPT Version :9

Sequence 1:NP_001269325.1 Gene:HPCAL4 / 51440 HGNCID:18212 Length:191 Species:Homo sapiens
Sequence 2:NP_572437.2 Gene:CG2256 / 31727 FlyBaseID:FBgn0029995 Length:324 Species:Drosophila melanogaster


Alignment Length:210 Identity:47/210 - (22%)
Similarity:93/210 - (44%) Gaps:36/210 - (17%)


- Green bases have known domain annotations that are detailed below.


Human     1 MGKTNSKLAPEVLEDLVQNTEFSEQELK---QWYKGFLKDCPSGILNLEE--------------- 47
            |.:.:.|:.|::|:.|.:.|.|::.||.   :.|:..:.:|......|..               
  Fly   101 MDELSGKVNPKLLDSLRKKTRFTKDELDALCRIYRKLVSNCQYAAKTLASSSSSAAIAKPHAAVE 165

Human    48 ------FQQLYIKFFPYGDASKFAQHAFRTFDKNGDG-TIDFREFICALSVTSRGSFEQKLNWAF 105
                  |::|....|.........:..|.::||..:| .:....::..||...||:..::..:.|
  Fly   166 GIDRIVFRELLHSTFDIVTEEILMERIFCSWDKAHEGLPLRLEGWLIGLSTFLRGTPAERAAFCF 230

Human   106 EMYDLDGDGRITRLEMLEIIEAIYKMVGTVIMMRMNQD---GLTPQQRVDKIFKKMDQDKDDQIT 167
            .:|||:.||.||:.||..::.      ..:|....::|   |:  :..|:.:.||.|.|||.:::
  Fly   231 RVYDLNTDGFITKDEMFTLLR------NCLIKQPQDEDPDEGV--KDLVEIVLKKFDLDKDGKVS 287

Human   168 LEEFKEAAKSDPSIV 182
            ||:|.....::|.::
  Fly   288 LEDFMGTVTAEPLLI 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HPCAL4NP_001269325.1 FRQ1 13..181 CDD:227455 44/195 (23%)
CG2256NP_572437.2 EFh 228..292 CDD:238008 22/71 (31%)
EF-hand_7 229..292 CDD:290234 22/70 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143270
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.