DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CSAD and SecS

DIOPT Version :9

Sequence 1:XP_024304779.1 Gene:CSAD / 51380 HGNCID:18966 Length:620 Species:Homo sapiens
Sequence 2:NP_649556.3 Gene:SecS / 40681 FlyBaseID:FBgn0037347 Length:478 Species:Drosophila melanogaster


Alignment Length:531 Identity:107/531 - (20%)
Similarity:182/531 - (34%) Gaps:159/531 - (29%)


- Green bases have known domain annotations that are detailed below.


Human   145 PEEL--KQLLDLEL---RSQGESQKQILERCRAVIRYSVKTGHPRFFNQLFSGLDPHALAGRIIT 204
            ||:|  ...|.|.|   ||:..|.|::||:     |...|.|   :.::....| .|.||     
  Fly     9 PEKLVPDNYLQLGLAAQRSKQRSFKELLEK-----RKLPKNG---WSDERIEEL-VHMLA----- 59

Human   205 ESLNTSQYTYEIAPVFVLMEEE--VLRKLRALVGWSSGDGIFCPG----------GS-----ISN 252
             ||:::.|.:::.    |.|.|  :..||.|...::.|.||...|          ||     ::|
  Fly    60 -SLDSNNYPHKVG----LGEREARIACKLVARRHYNFGHGIGRSGDLLEAQPKAAGSTLLARLTN 119

Human   253 MYAVNLARYQRYPDCKQRGLRTLP---PLALFTSKEVGKRHRPNPGLLILISSHVTTPSRRELRF 314
            ...::|.|....|.|  .|...:|   .:.|....:..::.||....::                
  Fly   120 ALILDLIRGIGLPSC--AGCFLVPMCTGMTLTLCLQSLRKRRPGARYVL---------------- 166

Human   315 WDLAPTVSEWSRLMREGKWSPRIWRGRLVWPRLRLTFHFFETFILDSGAVPFLVSATSGTTVLGA 379
                     |||:.::..:..                      |..:|.||.::..    .:.| 
  Fly   167 ---------WSRIDQKSCFKA----------------------ITATGLVPVVIPC----LIKG- 195

Human   380 FDPLEAIADVCQRHGLWLHVDAAWGGSVLLSQTHRHLLDGIQRADSVA--------WN-PHKL-L 434
             :.|....|:.:.....|.||     |:|...|..... ..:.:|.:|        |. ||.: .
  Fly   196 -ESLNTNVDLFREKIKSLGVD-----SILCLYTTTSCF-APRNSDDIAEVSKLSKQWQIPHLVNN 253

Human   435 AAGLQCSALLLQ-DTSNLLKRCH--------------GSQASYLFQQDKFYDVALDTGDKVVQCG 484
            |.|||...::.| :.:|.:.|..              ||.....|.:...:|||.....: ....
  Fly   254 AYGLQAKEIVNQLECANRVGRIDYFVQSSDKNLLVPVGSAIVASFNESVLHDVASTYAGR-ASGS 317

Human   485 RRVDCLKLWLMWKAQGDQGLERRIDQAFVLARYLVEEMKK--REGFELVMEPEFVNVCFWFVPPS 547
            :.:|.|...|   :.|..|.....||......||.|.::|  ....|:|::..|.::.......:
  Fly   318 QSLDVLMTLL---SLGRNGFRLLFDQRGENFNYLRENLRKFAEPRGEIVIDSRFNSISLAITLAT 379

Human   548 LRGKQESPDYHERLSKVAPVLKERMVK-------------EGSMMIGYQPHGTRGNF---FRVVV 596
            |.|     |..:.::|:..:|..|.|.             :|...:.:..|  |.|.   :..|.
  Fly   380 LAG-----DQMKSITKLGSMLHMRGVSGARVIVPGQNKTIDGHEFLDFGSH--RSNLQVPYLTVA 437

Human   597 ANSALTCADMD 607
            |...:|..::|
  Fly   438 AGIGITREEID 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CSADXP_024304779.1 DOPA_deC_like 185..616 CDD:99743 92/486 (19%)
SecSNP_649556.3 AAT_I 12..457 CDD:302748 105/528 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.