DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CSAD and amd

DIOPT Version :9

Sequence 1:XP_024304779.1 Gene:CSAD / 51380 HGNCID:18966 Length:620 Species:Homo sapiens
Sequence 2:NP_476592.1 Gene:amd / 35188 FlyBaseID:FBgn0000075 Length:510 Species:Drosophila melanogaster


Alignment Length:534 Identity:119/534 - (22%)
Similarity:194/534 - (36%) Gaps:150/534 - (28%)


- Green bases have known domain annotations that are detailed below.


Human   144 EPEELKQLLDLELRSQGESQKQILERCRAVIR--------------YSVKTGHPRFFNQLFSGLD 194
            ||..|..||..|:..:.|:.|.:|.....||:              |...|.:|           
  Fly    34 EPGYLLDLLPTEMPEEPEAWKDVLGDISRVIKPGLTHWQSPHMHAYYPTSTSYP----------- 87

Human   195 PHALAGRIITESLNTSQYTYEIAPVFVLMEEEVL------RKLRALVGWSSGDGIFCPGGSI--- 250
              ::.|.::........:::..:|....:|..|:      .||.|....:| ||   |||.:   
  Fly    88 --SIVGEMLASGFGVIGFSWICSPACTELEVVVMDWLAKFLKLPAHFQHAS-DG---PGGGVIQG 146

Human   251 ----SNMYAVNLARYQ-------RYPDCKQRGLRTLPPLALFTSKEVGKRHRPNPGLLILISSHV 304
                :.:.||..||.|       .:|:..:..:|                     |.|:..||..
  Fly   147 SASEAVLVAVLAAREQAVANYRESHPELSESEVR---------------------GRLVAYSSDQ 190

Human   305 TTPSRRELRFWDLAPTVSEWSRLMREGKWSPRIWRGRLVWPRLRLTFHFFETFIL---------- 359
            :.....:.......|.     ||:..|                       |.|:|          
  Fly   191 SNSCIEKAGVLAAMPI-----RLLPAG-----------------------EDFVLRGDTLRGAIE 227

Human   360 ---DSGAVPFLVSATSGTTVLGAFDPLEAIADVCQRHGLWLHVDAAWGGSVLLSQTHRHLLDGIQ 421
               .:|.:|.:..||.|||...|:|.:|:::.||:...:|||||||:.|.....:....|..|:.
  Fly   228 EDVAAGRIPVICVATLGTTGTCAYDDIESLSAVCEEFKVWLHVDAAYAGGAFALEECSDLRKGLD 292

Human   422 RADSVAWNPHKLLAAGLQCSALLLQDTSNL----------LKRCHGSQASYLFQQDKFYDVALDT 476
            |.||:.:|.||.:.....|||:.|:|.:.:          ||..|..|:.  ....:.:.:.|  
  Fly   293 RVDSLNFNLHKFMLVNFDCSAMWLRDANKVVDSFNVDRIYLKHKHEGQSQ--IPDFRHWQIPL-- 353

Human   477 GDKVVQCGRRVDCLKLWLMWKAQGDQGLERRIDQAFVLARYLVEEMKKREGFELVMEPEFVNVCF 541
                   |||...||:|:.::..|.:||...:.:...||:...:.:.|...||||.......|||
  Fly   354 -------GRRFRALKVWITFRTLGAEGLRNHVRKHIELAKQFEQLVLKDSRFELVAPRALGLVCF 411

Human   542 WFVPPSLRGKQESPDYHERLSKVAPVLKERMVKEGSMMIGYQPHGTRGNFFRVVVANSALTCADM 606
                   |.|.:        :::...|.:|::....:.:....|..| .|.|.||.......:|:
  Fly   412 -------RPKGD--------NEITTQLLQRLMDRKKIYMVKAEHAGR-QFLRFVVCGMDTKASDI 460

Human   607 DFLLNELERLGQDL 620
            ||...|:|....||
  Fly   461 DFAWQEIESQLTDL 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CSADXP_024304779.1 DOPA_deC_like 185..616 CDD:99743 103/473 (22%)
amdNP_476592.1 Pyridoxal_deC 35..414 CDD:278699 102/462 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.