DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MRPS17 and RpS11

DIOPT Version :10

Sequence 1:NP_057053.1 Gene:MRPS17 / 51373 HGNCID:14047 Length:130 Species:Homo sapiens
Sequence 2:NP_725114.1 Gene:RpS11 / 36321 FlyBaseID:FBgn0033699 Length:155 Species:Drosophila melanogaster


Alignment Length:88 Identity:26/88 - (29%)
Similarity:37/88 - (42%) Gaps:13/88 - (14%)


- Green bases have known domain annotations that are detailed below.


Human     8 VHARWIVGKVIGTKMQKTAKVRVTRLVLDPYLLKY--FNKR-KTYFAH--DALQQCTVGDIVLLR 67
            :..|.:.|.|...|||:|..:|...|   .::.||  |.|| :....|  ...:....||||.:.
  Fly    65 IRGRILTGVVRKAKMQRTIVIRRDYL---HFVRKYSRFEKRHRNMSVHCSPVFRDVEHGDIVTIG 126

Human    68 ALPVPRAKHVKHELAEIVFKVGK 90
            ... |.:|.|:..    |.||.|
  Fly   127 ECR-PLSKTVRFN----VLKVSK 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MRPS17NP_057053.1 Ribosomal_uS17 11..84 CDD:466775 22/77 (29%)
RpS11NP_725114.1 PTZ00241 1..155 CDD:240326 26/88 (30%)

Return to query results.
Submit another query.