DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment POMP and Pomp

DIOPT Version :10

Sequence 1:NP_057016.1 Gene:POMP / 51371 HGNCID:20330 Length:141 Species:Homo sapiens
Sequence 2:NP_610057.1 Gene:Pomp / 35342 FlyBaseID:FBgn0032884 Length:134 Species:Drosophila melanogaster


Alignment Length:129 Identity:58/129 - (44%)
Similarity:75/129 - (58%) Gaps:13/129 - (10%)


- Green bases have known domain annotations that are detailed below.


Human    16 VTELSASG----PFESHDLLRKGFSCVKNELLPSHPLELSEKNFQLNQDKMNFSTLRNIQGLFAP 76
            |:.|:|:|    |.|::.|         |:|...|.|..||.|:..:|...|...|||.:||..|
  Fly    13 VSVLNATGRVGMPTEANCL---------NQLAHVHRLRDSELNYNEHQYNRNMQMLRNHEGLGVP 68

Human    77 LKLQMEFKAVQQVQRLPFLSSSNLSLDVLRGNDETIGFEDILNDPSQSEVMGEPHLMVEYKLGL 140
            ||:.||..|.:||.|||||||||...|||.|..::|||||.:|.|..||.|.:||.:||..||:
  Fly    69 LKMGMERFAARQVGRLPFLSSSNFMDDVLTGRCDSIGFEDFMNLPENSEHMRQPHAVVEKSLGI 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
POMPNP_057016.1 UMP1 25..138 CDD:461627 51/112 (46%)
High-affinity association with the preproteasome 68..72 2/3 (67%)
PompNP_610057.1 UMP1 15..130 CDD:461627 55/123 (45%)

Return to query results.
Submit another query.