DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment ZNF771 and klf10

DIOPT Version :9

Sequence 1:	NP_001135777.1	Gene:	ZNF771 / 51333	HGNCID:	29653	Length:	317	Species:	Homo sapiens
Sequence 2:	XP_002931580.2	Gene:	klf10 / 100490524	XenbaseID:	XB-GENE-854761	Length:	465	Species:	Xenopus tropicalis

Alignment Length:	139	Identity:	52/139 - (37%)
Similarity:	74/139 - (53%)	Gaps:	19/139 - (13%)

- Green bases have known domain annotations that are detailed below.

Human    15 MQEEMVLLVKGEEDEGEEKYEVVKLKIPMDNKEVP-GEAPAP-SADPA--RPHAC--PDCGRAFA 73
            :|....||..|           .||.:......:| .|..|| :.|.:  |.|.|  |.||:.:.
Frog   313 LQNTKTLLPSG-----------TKLSLIAPAPGIPSSETKAPMNTDTSRIRSHVCTQPGCGKTYF 366

Human    74 RRSTLAKHARTHTGERPFGCT--ECGRRFSQKSALTKHGRTHTGERPYECPECDKRFSAASNLRQ 136
            :.|.|..|.||||||:||.|:  .|.|:|::...|::|.||||||:.:.||:||:||..:.:|.:
Frog   367 KSSHLKAHMRTHTGEKPFSCSWEGCERKFARSDELSRHRRTHTGEKKFACPKCDRRFMRSDHLTK 431

Human   137 HRRRHTGEK 145
            |.|||...|
Frog   432 HARRHLSTK 440

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
ZNF771	NP_001135777.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..63		12/51 (24%)
		COG5048	<62..221	CDD:227381	40/88 (45%)
		C2H2 Zn finger	65..85	CDD:275368	8/21 (38%)
		C2H2 Zn finger	93..113	CDD:275368	7/21 (33%)
		C2H2 Zn finger	121..141	CDD:275368	9/19 (47%)
		C2H2 Zn finger	149..169	CDD:275368
		C2H2 Zn finger	177..197	CDD:275368
		C2H2 Zn finger	205..225	CDD:275368
		zf-H2C2_2	217..242	CDD:404364
		C2H2 Zn finger	233..253	CDD:275368
		zf-H2C2_2	245..269	CDD:404364
klf10	XP_002931580.2	KLF10_N	32..354	CDD:409241	12/51 (24%)
		zf-C2H2	354..378	CDD:395048	9/23 (39%)
		C2H2 Zn finger	359..378	CDD:275368	7/18 (39%)
		zf-H2C2_2	370..397	CDD:404364	14/26 (54%)
		C2H2 Zn finger	386..408	CDD:275368	7/21 (33%)
		zf-C2H2	414..436	CDD:395048	9/21 (43%)
		C2H2 Zn finger	416..436	CDD:275368	9/19 (47%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
NCBI	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	1	1.000	-	-
TreeFam	0	0.000	Not matched by this tool.
	2	1.910