DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RSRC1 and nhp2

DIOPT Version :9

Sequence 1:NP_001258767.1 Gene:RSRC1 / 51319 HGNCID:24152 Length:334 Species:Homo sapiens
Sequence 2:NP_594717.1 Gene:nhp2 / 2542369 PomBaseID:SPAC1782.10c Length:154 Species:Schizosaccharomyces pombe


Alignment Length:141 Identity:28/141 - (19%)
Similarity:57/141 - (40%) Gaps:26/141 - (18%)


- Green bases have known domain annotations that are detailed below.


Human   155 KDKELHNIKRGESGNIKAGLEHLPPA----------EQAKARLQLVLEAAAKADEALKAKERNEE 209
            |||:.|.    .||:.:...:...||          ::...::...::.|:|....|:. .:...
pombe     3 KDKKDHK----HSGSTEDEYDSYLPALMPIAKPLAPKKLNKKMMKTVKKASKQKHILRG-VKEVV 62

Human   210 EAKRRKEEDQATL---VEQVKRVKEIEAIESDSFVQQTFRSSKEVKKSVEPSEVKQATSTSGPAS 271
            :|.|:.|:....|   :..:..:..|..:..|:.|...:..|||:        :.:|::|..|.|
pombe    63 KAVRKGEKGLVILAGDISPMDVISHIPVLCEDNNVPYLYTVSKEL--------LGEASNTKRPTS 119

Human   272 AVADPPSTEKE 282
            .|...|..:|:
pombe   120 CVMIVPGGKKK 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RSRC1NP_001258767.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..179 6/23 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 201..220 4/18 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 243..290 10/40 (25%)
nhp2NP_594717.1 Ribosomal_L7Ae 39..133 CDD:279573 20/101 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1358
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.