DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PHF21A and mit1

DIOPT Version :9

Sequence 1:XP_011518459.1 Gene:PHF21A / 51317 HGNCID:24156 Length:688 Species:Homo sapiens
Sequence 2:NP_595385.1 Gene:mit1 / 2541336 PomBaseID:SPBP35G2.10 Length:1418 Species:Schizosaccharomyces pombe


Alignment Length:118 Identity:34/118 - (28%)
Similarity:45/118 - (38%) Gaps:36/118 - (30%)


- Green bases have known domain annotations that are detailed below.


Human   442 YNAVLGFGALTPTSPQSSHPDSPENEKTETTFTFPAPVQPVSLPSPTSTDGDIHEDFCSVC---- 502
            :|....||:   :...||..:|.||:.....|            |...:||.....|..||    
pombe   168 FNDTSDFGS---SDLSSSEIESTENDNKAPYF------------SLLYSDGFDFIKFLHVCVCVK 217

Human   503 ------RKSGQ-LLMCDTCSRVYHLDCLDPPLKTIPK--------GMWICPRC 540
                  |.||: .:.||.||.|||.||  .||.::.|        ..:|||.|
pombe   218 CHGREHRSSGKNFVYCDHCSNVYHYDC--SPLPSLNKETRNYSQQNGFICPLC 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PHF21AXP_011518459.1 ING <382..544 CDD:331088 34/118 (29%)
PHD_PHF21A 498..540 CDD:276998 21/60 (35%)
mit1NP_595385.1 PHD 214..268 CDD:214584 18/55 (33%)
SNF2_N 559..847 CDD:278600
DEXDc 577..720 CDD:238005
Helicase_C 870..985 CDD:278689
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0383
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.