DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TLR8 and kek5

DIOPT Version :10

Sequence 1:NP_057694.2 Gene:TLR8 / 51311 HGNCID:15632 Length:1059 Species:Homo sapiens
Sequence 2:NP_573382.1 Gene:kek5 / 32930 FlyBaseID:FBgn0031016 Length:931 Species:Drosophila melanogaster


Alignment Length:290 Identity:68/290 - (23%)
Similarity:117/290 - (40%) Gaps:91/290 - (31%)


- Green bases have known domain annotations that are detailed below.


Human   567 ALTEL-----SDLEVLDLSYNS------HYFRIAGVTH-HLEFIQNFTNLKVLNLSHNNIYTLTD 619
            |||::     ::::|||.::|.      ..|.:||:.: |..|::|.|..:|...:...::.   
  Fly    63 ALTKIPQDMSNEMQVLDFAHNQIPELRREEFLLAGLPNVHKIFLRNCTIQEVHREAFKGLHI--- 124

Human   620 KYNLESKSLVELVFSGNRLDILWNDDDNRYISIFKGLKNLTRLDLSLNRLKHIPNEAFLNLPASL 684
                    |:||..||||:..|       :...|.||:.|..:.::.|.::.:||..|:|| :.|
  Fly   125 --------LIELDLSGNRIREL-------HPGTFAGLEKLRNVIINNNEIEVLPNHLFVNL-SFL 173

Human   685 TELHINDNMLKFFNWTLLQQFPRLELLDLRGNKLLFLTDSLSDFTSSLRTLLLSHNRISHLPSGF 749
            :.:...:|.|:           :::|....|             |.:|..:.|..||:|||....
  Fly   174 SRIEFRNNRLR-----------QVQLHVFAG-------------TMALSAISLEQNRLSHLHKET 214

Human   750 LSEVSSLKHLDLSSNLLKTINKSALETKTTTKLSMLELHGNPFECTCDIGDFRRWMDEHLNVKI- 813
            ..::..|.|                          |.|.||.:.|:|::.|||   |..::.:: 
  Fly   215 FKDLQKLMH--------------------------LSLQGNAWNCSCELQDFR---DFAISKRLY 250

Human   814 -PRLVDVICASPGDQRGK--SIVSLELTTC 840
             |   ...|..|...|||  |.|..|...|
  Fly   251 TP---PTDCQEPPQLRGKLWSEVPSENFAC 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TLR8NP_057694.2 LRR 81..460 CDD:443914
leucine-rich repeat 83..106 CDD:275380
leucine-rich repeat 107..144 CDD:275380
leucine-rich repeat 145..165 CDD:275380
leucine-rich repeat 166..189 CDD:275380
leucine-rich repeat 190..220 CDD:275380
leucine-rich repeat 221..241 CDD:275380
leucine-rich repeat 242..265 CDD:275380
leucine-rich repeat 266..306 CDD:275380
leucine-rich repeat 307..330 CDD:275380
leucine-rich repeat 331..356 CDD:275380
leucine-rich repeat 387..413 CDD:275380
leucine-rich repeat 414..437 CDD:275380
LRR 483..>793 CDD:443914 52/237 (22%)
leucine-rich repeat 504..524 CDD:275380
leucine-rich repeat 525..549 CDD:275380
leucine-rich repeat 550..573 CDD:275380 3/10 (30%)
leucine-rich repeat 574..603 CDD:275380 10/35 (29%)
leucine-rich repeat 604..658 CDD:275380 12/53 (23%)
leucine-rich repeat 659..683 CDD:275380 7/23 (30%)
leucine-rich repeat 684..707 CDD:275380 3/22 (14%)
leucine-rich repeat 708..730 CDD:275380 2/21 (10%)
leucine-rich repeat 732..755 CDD:275380 7/22 (32%)
leucine-rich repeat 756..775 CDD:275380 2/18 (11%)
PCC 760..>847 CDD:188093 20/85 (24%)
TIR 898..1040 CDD:214587
kek5NP_573382.1 LRR <76..>229 CDD:443914 47/221 (21%)
leucine-rich repeat 76..100 CDD:275380 7/23 (30%)
leucine-rich repeat 101..124 CDD:275380 5/22 (23%)
leucine-rich repeat 125..148 CDD:275380 11/29 (38%)
leucine-rich repeat 149..172 CDD:275380 7/23 (30%)
leucine-rich repeat 173..196 CDD:275380 6/46 (13%)
leucine-rich repeat 197..220 CDD:275380 7/22 (32%)
LRRCT 229..277 CDD:214507 16/53 (30%)
Ig 296..379 CDD:472250
Ig strand B 296..300 CDD:409353
Ig strand C 309..313 CDD:409353
Ig strand E 345..349 CDD:409353
Ig strand F 359..364 CDD:409353
Ig strand G 372..375 CDD:409353
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.