DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CDKL3 and CG7236

DIOPT Version :9

Sequence 1:XP_011541731.1 Gene:CDKL3 / 51265 HGNCID:15483 Length:619 Species:Homo sapiens
Sequence 2:NP_608950.3 Gene:CG7236 / 33798 FlyBaseID:FBgn0031730 Length:438 Species:Drosophila melanogaster


Alignment Length:329 Identity:145/329 - (44%)
Similarity:194/329 - (58%) Gaps:29/329 - (8%)


- Green bases have known domain annotations that are detailed below.


Human     1 MEMYETLGKVGEGSYGTVMKCKHKNTGQIVAIKIFYE-RPEQSVNKIAMREIKFLKQFHHENLVN 64
            |:.||.|.::||||||.|.||:.:.||.:||:|.|.| ..:.::.|||:|||:.||...|.|||:
  Fly    47 MDRYEKLSRLGEGSYGVVYKCRDRETGALVAVKRFVESEDDPAIRKIALREIRLLKNLKHPNLVS 111

Human    65 LIEVFRQKKKIHLVFEFIDHTVLDELQHYCHGLESKRLRKYLFQILRAIDYLHSNNIIHRDIKPE 129
            |:||||:|:::||||||.:.|||.||:.:..|......::..:|.|..:.|.|....:|||||||
  Fly   112 LLEVFRRKRRLHLVFEFCELTVLHELERHPQGCPEHLTKQICYQTLLGVAYCHKQGCLHRDIKPE 176

Human   130 NILVSQSGITKLCDFGFARTLAAPGDIYTDYVATRWYRAPELVLKDTSYGKYVYFGILSAFPRPV 194
            |||::..|..|||||||||.| :||:.|||||||||||||||::.||.||            .||
  Fly   177 NILLTAQGQVKLCDFGFARML-SPGENYTDYVATRWYRAPELLVGDTQYG------------TPV 228

Human   195 DIWALGCMIIEMATGNPYLPSSSDLDLLHKIVLKVGNLSP-HLQNIFSKSPIFAGVVLPQVQHPK 258
            |:||:||:..|:..|....|..||:|.|:.|...:|:|.| |:| ||.::..|.|:.||.....:
  Fly   229 DVWAIGCLFAELVRGEALWPGRSDVDQLYLIRKTLGDLLPRHIQ-IFGQNEYFKGITLPVPPTLE 292

Human   259 NARKKYP---KLNGLLADIVHACLQIDPADRISSSDLLHHEYFTRDGFIEKFMPELKAKLLQEAK 320
            ....|.|   :.|.|..|.:..||..||..|.|...|..|.||  |.:|        ||..:...
  Fly   293 PLEDKMPAKSQQNPLTIDFLKKCLDKDPTKRWSCEKLTKHSYF--DDYI--------AKQRELEH 347

Human   321 VNSL 324
            ||||
  Fly   348 VNSL 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CDKL3XP_011541731.1 STKc_CDKL2_3 2..298 CDD:270836 134/300 (45%)
CG7236NP_608950.3 STKc_CDKL1_4 48..335 CDD:270837 134/300 (45%)
Pkinase 50..335 CDD:278497 134/298 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D398098at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.