DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PBDC1 and CG7519

DIOPT Version :10

Sequence 1:NP_057584.2 Gene:PBDC1 / 51260 HGNCID:28790 Length:233 Species:Homo sapiens
Sequence 2:NP_649318.1 Gene:CG7519 / 40377 FlyBaseID:FBgn0037087 Length:160 Species:Drosophila melanogaster


Alignment Length:146 Identity:75/146 - (51%)
Similarity:102/146 - (69%) Gaps:1/146 - (0%)


- Green bases have known domain annotations that are detailed below.


Human    14 ELVSVAHALSLPAESYGNDPDIEMAWAMRAMQHAEVYYKLISSVDPQFLKLTKVDDQIYSEFRKN 78
            |::..|..||.|||.:|||..:|..||.:|::||||::.||:||.|..||||..|||||:.||::
  Fly     2 EMMHGASLLSRPAEEFGNDTLVEEMWAAKALEHAEVHFNLITSVHPSQLKLTPYDDQIYATFRQD 66

Human    79 FETLRIDVLDPEELKSESAKEKWRPFCLKFNGIVEDFNYGTLLRLDCSQGYTEENTIFAPRIQFF 143
            |..|.:..|..:.|||.:||.|||.|..|||.: :|::||||:|.|.|:.::.:|:||..|:||.
  Fly    67 FPDLHVGRLTDDILKSATAKLKWRQFAEKFNKL-DDYSYGTLMRADASREFSPDNSIFVFRVQFL 130

Human   144 AIEIARNREGYNKAVY 159
            ||||||||||.|...|
  Fly   131 AIEIARNREGLNDEAY 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PBDC1NP_057584.2 Polysacc_synt_4 35..159 CDD:368048 64/123 (52%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 167..233
CG7519NP_649318.1 Polysacc_synt_4 23..147 CDD:368048 65/125 (52%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.