DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MARCHF2 and CG1317

DIOPT Version :10

Sequence 1:NP_057580.3 Gene:MARCHF2 / 51257 HGNCID:28038 Length:246 Species:Homo sapiens
Sequence 2:NP_647715.2 Gene:CG1317 / 38300 FlyBaseID:FBgn0035333 Length:988 Species:Drosophila melanogaster


Alignment Length:151 Identity:44/151 - (29%)
Similarity:64/151 - (42%) Gaps:39/151 - (25%)


- Green bases have known domain annotations that are detailed below.


Human    55 LDTPSDGPFCRICH-EGANGECLLSPCGCTGTLGAVHKSCLEKWLSSSNTSYCELCHTEFAVE-- 116
            :|..|.|..||:|. |......|..||.|||::..:|:.||..|:..|:..|||||...|:.:  
  Fly     1 MDDLSQGDICRVCRCEAQPDRPLFYPCICTGSIKYIHQDCLMLWMRYSHKEYCELCSYSFSFQPI 65

Human   117 ---KRPRPLTEWLKDPGPRTEKRTLCCDMVCFLFITPLAAISGWLCLRGAQDHLRLHSQLEAVGL 178
               ..||.|.  :||                 :.:..::|:     |.||:  ..||..|  |||
  Fly    66 YAPDMPRVLP--IKD-----------------VLVGLMSAV-----LEGAR--CWLHYTL--VGL 102

Human   179 IALTIALFTIYVLWTLVSFRY 199
                 |.|.:..|....::||
  Fly   103 -----AWFGVVPLSAYRTYRY 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MARCHF2NP_057580.3 Required for inhibition of HIV-1 virus production and VSV G protein expression. /evidence=ECO:0000269|PubMed:29573664 56..116 24/60 (40%)
RING_CH-C4HC3_MARCH2 62..113 CDD:319722 20/51 (39%)
Required for interaction with IKBKG. /evidence=ECO:0000269|PubMed:32935379 121..246 18/79 (23%)
CG1317NP_647715.2 SSM4 9..>206 CDD:227510 41/143 (29%)
RING_CH-C4HC3_MARCH6 9..58 CDD:438362 20/48 (42%)
SSM4 <359..>554 CDD:227510
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.