DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PDZD11 and veli

DIOPT Version :10

Sequence 1:XP_016885057.1 Gene:PDZD11 / 51248 HGNCID:28034 Length:172 Species:Homo sapiens
Sequence 2:NP_733076.2 Gene:veli / 43003 FlyBaseID:FBgn0039269 Length:246 Species:Drosophila melanogaster


Alignment Length:125 Identity:41/125 - (32%)
Similarity:65/125 - (52%) Gaps:6/125 - (4%)


- Green bases have known domain annotations that are detailed below.


Human    38 PYDDYPVVFLPAYENPPAWIPPHERVHHPDYNNELTQFLPRTITLKKPPGAQLGFNIRGGKASQL 102
            || :..:..:|.|......|   .:|:.|.....:...:.:.:::.....:.||||:.|||....
  Fly   106 PY-ELRIEGIPLYHKTNTLI---VKVYRPRIYVSIIHLIWKALSIFNFCFSGLGFNVMGGKEQNS 166

Human   103 GIFISKVIPDSDAHR-AGLQEGDQVLAVNDVDFQDIEHSKAVEILKTA-REISMRVRFFP 160
            .|:||::||...|.| .||:.|||:|:||.|..:...|.||||:||.| ..:.:.||:.|
  Fly   167 PIYISRIIPGGVADRHGGLKRGDQLLSVNGVSVEGENHEKAVELLKQAVGSVKLVVRYTP 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PDZD11XP_016885057.1 PDZ_PDZD11-like 78..160 CDD:467234 33/83 (40%)
veliNP_733076.2 L27 14..66 CDD:460717
PDZ_Lin-7-like 90..226 CDD:467258 40/123 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.