DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RAB9B and rab-1

DIOPT Version :9

Sequence 1:NP_057454.1 Gene:RAB9B / 51209 HGNCID:14090 Length:201 Species:Homo sapiens
Sequence 2:NP_503397.1 Gene:rab-1 / 178620 WormBaseID:WBGene00004266 Length:205 Species:Caenorhabditis elegans


Alignment Length:160 Identity:67/160 - (41%)
Similarity:101/160 - (63%) Gaps:6/160 - (3%)


- Green bases have known domain annotations that are detailed below.


Human     7 LLKVILLGDGGVGKSSLMNRYVTNKFDSQAFHTIGVEFLNRDLEVDGRFVTLQIWDTAGQERFKS 71
            |.|::|:||.|||||.|:.|:..:.:......||||:|..|.:|:||:.:.||||||||||||::
 Worm    11 LFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRT 75

Human    72 LRTPFYRGADCCLLTFSVDDRQSFENLGNWQKEFIYYADVKDPEHFPFVVLGNKVD-KEDRQVTT 135
            :.:.:||||...::.:.:.|:::|.|:..|.:|...||    .|:...:::|||.| ...|.|.|
 Worm    76 ITSSYYRGAHGIIVVYDITDQETFNNVKQWLQEIDRYA----CENVNKLLVGNKCDLTAKRAVET 136

Human   136 EEAQTWCMENGDYPYLETSAKDDTNVTVAF 165
            :.||.:..:.| .|:||||||..|||..||
 Worm   137 QAAQDYAGQLG-IPFLETSAKSSTNVEQAF 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RAB9BNP_057454.1 Rab9 3..172 CDD:206697 67/160 (42%)
Effector region. /evidence=ECO:0000250 36..44 4/7 (57%)
rab-1NP_503397.1 Rab1_Ypt1 10..175 CDD:206661 67/160 (42%)
RAB 12..175 CDD:197555 66/159 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.