DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RAB9B and rab-7

DIOPT Version :9

Sequence 1:NP_057454.1 Gene:RAB9B / 51209 HGNCID:14090 Length:201 Species:Homo sapiens
Sequence 2:NP_496549.1 Gene:rab-7 / 174834 WormBaseID:WBGene00004271 Length:209 Species:Caenorhabditis elegans


Alignment Length:181 Identity:103/181 - (56%)
Similarity:128/181 - (70%) Gaps:3/181 - (1%)


- Green bases have known domain annotations that are detailed below.


Human     1 MSG--KSLLLKVILLGDGGVGKSSLMNRYVTNKFDSQAFHTIGVEFLNRDLEVDGRFVTLQIWDT 63
            |||  |..|||||:|||.||||:||||:||..:|.:|...|||.:||.||:.:|.|.||||||||
 Worm     1 MSGTRKKALLKVIILGDSGVGKTSLMNQYVNRRFSNQYKATIGADFLTRDVNIDDRTVTLQIWDT 65

Human    64 AGQERFKSLRTPFYRGADCCLLTFSVDDRQSFENLGNWQKEFIYYADVKDPEHFPFVVLGNKVDK 128
            ||||||:||...||||||||:|.|.|.:..||::|.:|:.||:..|..:||:|||||:||||||.
 Worm    66 AGQERFQSLGVAFYRGADCCVLAFDVTNAASFKSLDSWRDEFLIQASPRDPDHFPFVLLGNKVDL 130

Human   129 E-DRQVTTEEAQTWCMENGDYPYLETSAKDDTNVTVAFEEAVRQVLAVEEQ 178
            | .|.|:::.||:||...|:.||.|.|||:..||..||....|..||.|.|
 Worm   131 ESQRAVSSKRAQSWCQTKGNIPYYEVSAKEALNVEAAFLAIARDALARESQ 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RAB9BNP_057454.1 Rab9 3..172 CDD:206697 97/171 (57%)
Effector region. /evidence=ECO:0000250 36..44 3/7 (43%)
rab-7NP_496549.1 Rab7 10..181 CDD:206655 97/170 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0394
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.