DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CRBN and Crbn

DIOPT Version :10

Sequence 1:NP_057386.2 Gene:CRBN / 51185 HGNCID:30185 Length:442 Species:Homo sapiens
Sequence 2:NP_780566.1 Gene:Crbn / 58799 MGIID:1913277 Length:445 Species:Mus musculus


Alignment Length:66 Identity:16/66 - (24%)
Similarity:33/66 - (50%) Gaps:6/66 - (9%)


- Green bases have known domain annotations that are detailed below.


Human   168 KHLQKLKQQITE-DPEQTHSSSNKIGVFNASVRS-HLGQNSSSLNG----GDVINLRPNKQRTKR 226
            |.:|::..::|: ..:.:......:|:..|::.: |.|..:|.:.|    |..|:.||.:..|.|
Mouse   250 KPIQEVLVELTDGGVDYSFECIGNVGIMRAALEACHKGWGTSVIIGVAGAGQEISTRPFQLVTGR 314

Human   227 T 227
            |
Mouse   315 T 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CRBNNP_057386.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..45
LON_substr_bdg 80..317 CDD:426647 16/66 (24%)
CRBN_C_like 321..422 CDD:276940
CrbnNP_780566.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..48
LON_substr_bdg 83..320 CDD:426647 16/66 (24%)
CRBN_C_like 324..425 CDD:276940
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.