DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HSD17B14 and Hsdl2

DIOPT Version :10

Sequence 1:NP_057330.2 Gene:HSD17B14 / 51171 HGNCID:23238 Length:270 Species:Homo sapiens
Sequence 2:NP_651578.1 Gene:Hsdl2 / 43325 FlyBaseID:FBgn0039537 Length:412 Species:Drosophila melanogaster


Alignment Length:284 Identity:72/284 - (25%)
Similarity:114/284 - (40%) Gaps:55/284 - (19%)


- Green bases have known domain annotations that are detailed below.


Human     3 TGTRYAGKVVVVTGGGRGIGAGIVRAFVNSGARVVICDKDESGGRALEQELPGAVF--------- 58
            || :.||:.:.:||..||||..|.......||.:|:..|....    ..:|||.::         
  Fly     4 TG-KLAGRTLFITGASRGIGKEIALKAARDGANIVVAAKTAEP----HPKLPGTIYSAAEEIEKA 63

Human    59 ------ILCDVTQEDDVKTLVSETIRRFGRLDCVVNNAGHHPPPQRPEETSAQGFRQLLELNLLG 117
                  .:.||..|..|::.|...:.:||.:|.|:|||........| :|..:.:..:..:|..|
  Fly    64 GGKAYPCVVDVRDEQQVRSAVEAAVAKFGGIDIVINNASAISLTNTP-DTDMKRYDLMHNINTRG 127

Human   118 TYTLTKLALPYLRKS-QGNVINISSLVGAIGQ--AQAVPYVATKGAVTAMTKALALDESPYGVRV 179
            |:.::|:.||||:|| ..:::|||..:....:  ...|.|...|..::.....:|.:....|:.|
  Fly   128 TFLVSKVCLPYLKKSNHAHILNISPPLSMKPKWFGPHVAYTMAKYGMSMCVLGMAAEFKDEGISV 192

Human   180 NCISPGNIWTPLWEELAALMPDPRATIREG---MLAQP-LGRMGQPAEVGAAAVF--LASEANFC 238
            |.         ||         ||..|...   ||..| ..:..:..|:.|.|.:  |..|....
  Fly   193 NA---------LW---------PRTAIHTAAIEMLTGPDSAKWSRKPEIMADAAYAILTREPRQS 239

Human   239 TG-----IELLVTGGAE--LGYGC 255
            ||     .|:|.:.|..  ..|.|
  Fly   240 TGQFFVDDEVLESAGITDLTEYAC 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HSD17B14NP_057330.2 RDH_SDR_c 1..256 CDD:187638 72/284 (25%)
Hsdl2NP_651578.1 PRK08278 7..277 CDD:181349 70/280 (25%)
SCP2 306..408 CDD:442486
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.