DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HSD17B14 and CG17121

DIOPT Version :10

Sequence 1:NP_057330.2 Gene:HSD17B14 / 51171 HGNCID:23238 Length:270 Species:Homo sapiens
Sequence 2:NP_651114.1 Gene:CG17121 / 42721 FlyBaseID:FBgn0039043 Length:361 Species:Drosophila melanogaster


Alignment Length:180 Identity:53/180 - (29%)
Similarity:89/180 - (49%) Gaps:15/180 - (8%)


- Green bases have known domain annotations that are detailed below.


Human     8 AGKVVVVTGGGRGIGAGIVRAFVNSGARVVICDKDESG---GRALEQELPGAV--FILCDVTQED 67
            :|||.:|||||.|:|..|.......|.::.:.|.:..|   ...|..::|..|  ....||:...
  Fly    91 SGKVALVTGGGSGLGREICLELARRGCKLAVVDVNSKGCYETVELLSKIPRCVAKAYKNDVSSPR 155

Human    68 DVKTLVSETIRRFGRLDCVVNNAGHHPPPQRPEETSAQGFRQLLELNLLGTYTL-TKLALPYL-- 129
            :::.:.::..:..|.:|.:||||...|....|...|.: ...:|:|| ||:|.: ||..||.:  
  Fly   156 ELQLMAAKVEKELGPVDILVNNASLMPMTSTPSLKSDE-IDTILQLN-LGSYIMTTKEFLPKMIN 218

Human   130 RKSQGNVINISSLVGAIGQAQAVPYVATK----GAVTAMTKALALDESPY 175
            ||| |:::.:::|.|.:....|..|.|||    |.:.::...|.|.:..|
  Fly   219 RKS-GHLVAVNALAGLVPLPGAGIYTATKYGIEGFMESLRAELRLSDCDY 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HSD17B14NP_057330.2 RDH_SDR_c 1..256 CDD:187638 53/180 (29%)
CG17121NP_651114.1 Rossmann-fold NAD(P)(+)-binding proteins 94..338 CDD:473865 51/177 (29%)

Return to query results.
Submit another query.