DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EGFL7 and egfl7

DIOPT Version :9

Sequence 1:NP_057299.1 Gene:EGFL7 / 51162 HGNCID:20594 Length:273 Species:Homo sapiens
Sequence 2:NP_001072909.1 Gene:egfl7 / 780371 XenbaseID:XB-GENE-491413 Length:279 Species:Xenopus tropicalis


Alignment Length:275 Identity:138/275 - (50%)
Similarity:178/275 - (64%) Gaps:20/275 - (7%)


- Green bases have known domain annotations that are detailed below.


Human    11 WLLVLAVGG-TEHAYRPGRRVCAVRAHGDPVS--ESFVQRVYQPFLTTCDGHRACSTYRTIYRTA 72
            :||:||||| .||.||.|||:|:...|...||  :||||.|:.|.:|.|||||.||||||.|:.:
 Frog    11 YLLILAVGGAAEHLYRTGRRICSAAGHAGTVSVTQSFVQPVHSPIVTLCDGHRICSTYRTTYKVS 75

Human    73 YR---RSPGLAPARPRYACCPGWKRTSGLPGACGAAICQPPCRNGGSCVQPGRCRCPAGWRGDTC 134
            ||   |...|    |.|:|||||::......:||.|.|:.||||||:||...:|.|.|||||..|
 Frog    76 YRQVSRKTSL----PLYSCCPGWRKIEAHTHSCGQAGCRLPCRNGGTCVASNKCECSAGWRGIYC 136

Human   135 QSDVDECSARRGGCPQRCVNTAGSYWCQCWEGHSLSADGTLC-------VPKGGPPRVAPNPTGV 192
            |:||||||.....|.|.|||:||||.|.|..|:.|.|||..|       ||...||.|  :..|:
 Frog   137 QTDVDECSDGSHQCAQLCVNSAGSYHCGCLGGYRLMADGKSCDLVPKPTVPPASPPSV--HEQGL 199

Human   193 DSAMKEEVQRLQSRVDLLEEKLQLVLAPLHSLASQALEHGLPDPGSLLVHSFQQLGRIDSLSEQI 257
            ..:::||:..|::::::||:||.|:|.|..||.:.:.: ...||.:||.||.|||.|||||||||
 Frog   200 PHSVREEMAELRNKIEVLEQKLHLLLTPFQSLTTTSPD-ARADPIALLTHSLQQLDRIDSLSEQI 263

Human   258 SFLEEQLGSCSCKKD 272
            |||||:|.:||||.:
 Frog   264 SFLEERLETCSCKTE 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EGFL7NP_057299.1 EMI 29..93 CDD:369419 34/68 (50%)
EGF_CA <110..135 CDD:238011 15/24 (63%)
Cell attachment site 130..132 1/1 (100%)
FXa_inhibition 141..176 CDD:373209 18/34 (53%)
egfl7NP_001072909.1 EMI 40..95 CDD:369419 31/58 (53%)
EGF_CA 139..178 CDD:311536 22/38 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H9427
Inparanoid 00.000 Not matched by this tool.
NCBI 1 1.000 - -
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D266214at32523
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R10312
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.040

Return to query results.
Submit another query.