DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EGFL7 and Y64G10A.7

DIOPT Version :9

Sequence 1:NP_057299.1 Gene:EGFL7 / 51162 HGNCID:20594 Length:273 Species:Homo sapiens
Sequence 2:NP_001255802.1 Gene:Y64G10A.7 / 178377 WormBaseID:WBGene00013416 Length:1714 Species:Caenorhabditis elegans


Alignment Length:195 Identity:69/195 - (35%)
Similarity:88/195 - (45%) Gaps:42/195 - (21%)


- Green bases have known domain annotations that are detailed below.


Human    28 RRVCAVRAHGD----PVSESFVQRVYQPFLTT----CDG-HRACSTY--RTIYRTAYRRSPGLAP 81
            |.||   .|.:    .:.|..|| .|..::.:    |:| .::|:..  :|||...|::     .
 Worm    34 RNVC---PHEEVEIVTLKEPCVQ-AYTKYVRSRKPGCNGKFQSCAVRQPKTIYFHTYKK-----V 89

Human    82 ARPR----YACCPGWKRTSGLPGACGAAICQPP-CRNGGSCVQPGR-------CRCPAGWRGDTC 134
            .|.|    ..|||||....|..| |..|.|... |.|||:|| |..       |.||.|:.|..|
 Worm    90 NRTRRHTVAECCPGWVHRPGEAG-CQRANCSADLCHNGGTCV-PSEHNDNEQVCECPVGFTGAKC 152

Human   135 QSDVDECSARRGGCPQRCVNTAGSYWCQCWEGHSLSADGTLC-------VPKGG-PPRVAPNPTG 191
            |.|.:||.|..|||...||||.|:|:|:||.|..||.||..|       |..|| ..|...:|.|
 Worm   153 QYDANECMANNGGCEHECVNTIGTYYCRCWPGFELSGDGNTCSDIDECAVSNGGCSDRCVNSPGG 217

Human   192  191
             Worm   218  217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EGFL7NP_057299.1 EMI 29..93 CDD:369419 20/78 (26%)
EGF_CA <110..135 CDD:238011 12/32 (38%)
Cell attachment site 130..132 0/1 (0%)
FXa_inhibition 141..176 CDD:373209 19/34 (56%)
Y64G10A.7NP_001255802.1 EMI 35..105 CDD:284877 20/78 (26%)
FXa_inhibition 159..194 CDD:291342 19/34 (56%)
FXa_inhibition 200..235 CDD:291342 6/18 (33%)
FXa_inhibition 241..278 CDD:291342
vWFA <319..358 CDD:294047
FXa_inhibition 366..402 CDD:291342
vWFA <460..502 CDD:294047
FXa_inhibition 509..544 CDD:291342
FXa_inhibition 550..585 CDD:291342
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001719
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.