DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHCHD2 and CG31008

DIOPT Version :9

Sequence 1:NP_001307256.1 Gene:CHCHD2 / 51142 HGNCID:21645 Length:168 Species:Homo sapiens
Sequence 2:NP_733411.1 Gene:CG31008 / 318554 FlyBaseID:FBgn0051008 Length:114 Species:Drosophila melanogaster


Alignment Length:144 Identity:40/144 - (27%)
Similarity:63/144 - (43%) Gaps:36/144 - (25%)


- Green bases have known domain annotations that are detailed below.


Human     1 MPRGSRSRTSRMAPPASRAPQMRAAPRPAPVAQPPAAAPPSAVGSSAAAPRQPGLMAQMATTAAG 65
            |||..||                |:.:.......||..|  .|.:|..      :..:.|..|.|
  Fly     1 MPRKQRS----------------ASVKAGSTNYMPAVVP--TVTNSEM------VFKEAAAHAVG 41

Human    66 VAVGSAVGHTLGHAITGGFSGGSNAEPARPDITYQEPQGTQPAQQQQPCLYEIKQFLECAQNQGD 130
            ||.||.|||.:|..|||.|. ..:.:|...|:.           ::.||..|:|:||:|.::..|
  Fly    42 VAAGSVVGHAIGSGITGLFR-RRDQQPHHSDLV-----------EEGPCAKEMKEFLKCTEDNDD 94

Human   131 IKLCEGFNEVLKQC 144
            :.:|:.||:.:::|
  Fly    95 LSVCKEFNDAVRRC 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHCHD2NP_001307256.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..50 11/48 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 77..111 7/33 (21%)
CHCH 114..147 CDD:369061 11/31 (35%)
Cx9C motif 1. /evidence=ECO:0000255|PROSITE-ProRule:PRU01150 114..124 5/9 (56%)
Cx9C motif 2. /evidence=ECO:0000255|PROSITE-ProRule:PRU01150 134..144 3/9 (33%)
CG31008NP_733411.1 CHCH 78..111 CDD:284221 11/31 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 44 1.000 Domainoid score I12296
eggNOG 1 0.900 - - E1_KOG4090
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13523
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.