DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHCHD2 and CG31007

DIOPT Version :9

Sequence 1:NP_001307256.1 Gene:CHCHD2 / 51142 HGNCID:21645 Length:168 Species:Homo sapiens
Sequence 2:NP_733412.2 Gene:CG31007 / 318553 FlyBaseID:FBgn0051007 Length:176 Species:Drosophila melanogaster


Alignment Length:177 Identity:66/177 - (37%)
Similarity:90/177 - (50%) Gaps:38/177 - (21%)


- Green bases have known domain annotations that are detailed below.


Human     1 MPR----GSRSRTSRMAPPASRAPQM------RAAPRPAP-VAQP-----PAAAPPSAVGSS--A 47
            |||    |.|| |..|...:||:..:      |.:.:..| |.||     |||||.::..:|  .
  Fly     1 MPRQRSEGPRS-TGSMRRQSSRSSHVFATKPSRGSSKDLPAVQQPKKESLPAAAPAASAATSTET 64

Human    48 AAPRQPGLMAQMATTAAGVAVGSAVGHTLGHAITGGFSGGSNAEPARPDITYQEPQ--GTQPAQQ 110
            ..|........|||||||||.||||||.:|..:||.|.|...|.||:     ::||  |:..|..
  Fly    65 KGPSTADRFKDMATTAAGVAAGSAVGHAVGAGLTGMFQGRGQAAPAK-----EQPQQEGSLAASA 124

Human   111 QQ-----------PCLYEIKQFLECAQ-NQGDIKLCEGFNEVLKQCR 145
            .|           ||.:|::|||:|.: |..|:.:|:.|||.::|||
  Fly   125 SQSVPKPQLVEDGPCAFELRQFLKCTEDNSSDLSVCKEFNEAMQQCR 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHCHD2NP_001307256.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..50 21/66 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 77..111 12/35 (34%)
CHCH 114..147 CDD:369061 15/33 (45%)
Cx9C motif 1. /evidence=ECO:0000255|PROSITE-ProRule:PRU01150 114..124 5/9 (56%)
Cx9C motif 2. /evidence=ECO:0000255|PROSITE-ProRule:PRU01150 134..144 4/9 (44%)
CG31007NP_733412.2 CHCH 139..173 CDD:284221 15/33 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 44 1.000 Domainoid score I12296
eggNOG 1 0.900 - - E1_KOG4090
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54220
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13523
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2188
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
76.910

Return to query results.
Submit another query.