DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PHF11 and pie

DIOPT Version :10

Sequence 1:NP_001035533.1 Gene:PHF11 / 51131 HGNCID:17024 Length:331 Species:Homo sapiens
Sequence 2:NP_524740.2 Gene:pie / 44315 FlyBaseID:FBgn0005683 Length:582 Species:Drosophila melanogaster


Alignment Length:171 Identity:40/171 - (23%)
Similarity:63/171 - (36%) Gaps:45/171 - (26%)


- Green bases have known domain annotations that are detailed below.


Human    38 EKMEKRTCALCPKDVEYNVLYFAQ---SENIAAHENCLLYSSGLVECEDQDPLNPDRSFD----- 94
            |..::..|.:| |..:.:.|.|.:   ..|:..|..|||.|:.|          |.|..|     
  Fly     2 EDNKELQCLIC-KYSDTDDLVFGEWMIVRNLQVHYFCLLLSTHL----------PQRGGDSSGIL 55

Human    95 ---VESVKKEIQRGRKLKCKFCHKRGATVGCDLKNCNKNYHFFCAKKDDAVPQSDGVRGIYKLLC 156
               :..:::|.....|.||.:|:|.||::.||  .|...:|..|..::.||.:..|....|...|
  Fly    56 GFLLRDIREEAAAAEKRKCWYCNKIGASLQCD--RCRSLFHLKCGLENRAVFEFCGQYKSYCYKC 118

Human   157 QQHAQFPIIAQSAKFSGVKRKRGRKKPLSGNHVQPPETMKC 197
            :....:                  |:.|..|   ||....|
  Fly   119 RPMDDY------------------KRQLQSN---PPRNATC 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PHF11NP_001035533.1 ePHD_PHF11 45..159 CDD:277182 33/124 (27%)
pieNP_524740.2 PHD_SF 9..117 CDD:473978 32/120 (27%)
PHD_SF 224..>260 CDD:473978
PRK10263 <265..>493 CDD:236669
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.