DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RPL26L1 and mRpL24

DIOPT Version :10

Sequence 1:NP_057177.1 Gene:RPL26L1 / 51121 HGNCID:17050 Length:145 Species:Homo sapiens
Sequence 2:NP_523476.1 Gene:mRpL24 / 33703 FlyBaseID:FBgn0031651 Length:247 Species:Drosophila melanogaster


Alignment Length:95 Identity:26/95 - (27%)
Similarity:42/95 - (44%) Gaps:14/95 - (14%)


- Green bases have known domain annotations that are detailed below.


Human     8 TSDRS-KNRKRHFNAPSHVRRKIMSSPLSKELRQKYNVRSMPIRKDDEVQVVRGHYKGQQIGKVV 71
            |::|| ..:.|..|.|..||||::..|          :......:.|.::|:.|..||:| |.|.
  Fly    52 TTNRSWTGQFRQQNMPGTVRRKVLVEP----------IEDWSFFRGDRIEVLVGKDKGKQ-GIVT 105

Human    72 QVYRKKYVIYIERV--QREKANGTTVHVGI 99
            ||..::..:.:|.:  ...|..|.....||
  Fly   106 QVIPERNWVIVEGLNWHYRKVGGEKEFPGI 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RPL26L1NP_057177.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21 4/13 (31%)
Ribosomal_L26 8..122 CDD:465307 26/95 (27%)
PRK05431 109..>145 CDD:235461
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 122..145
mRpL24NP_523476.1 RplX 86..183 CDD:439968 15/51 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.