DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZDHHC9 and CG17196

DIOPT Version :9

Sequence 1:NP_001008223.1 Gene:ZDHHC9 / 51114 HGNCID:18475 Length:364 Species:Homo sapiens
Sequence 2:NP_651426.1 Gene:CG17196 / 43112 FlyBaseID:FBgn0039368 Length:276 Species:Drosophila melanogaster


Alignment Length:279 Identity:65/279 - (23%)
Similarity:107/279 - (38%) Gaps:69/279 - (24%)


- Green bases have known domain annotations that are detailed below.


Human    42 LFLILGTCTLFFAFECRYLAVQLSPAI--------PVFAAMLFLFSMATLLRTSFSDPGVIPRAL 98
            :||::.| ..||..:..|:|..:....        .:|.....|.::....|||.:     .::|
  Fly    29 IFLLVST-VFFFTLQVFYVAPDVHDGFMYKFFVISAIFTTYNILGNLLACYRTSSA-----VKSL 87

Human    99 PDEAAFIEMEIEATNGAVPQGQRPPPRIKNFQINNQIVKLKYCYTCKIFRPPRASHCSICDNCVE 163
            |.|.                 |.|.|..::.        ..||..|:...|||:.||::|..|:.
  Fly    88 PQER-----------------QIPKPGTEHL--------WHYCDICQKLMPPRSWHCALCKCCIL 127

Human   164 RFDHHCPWVGNCVGKRNYRYFY------LFILSLSLLTIYVFAFNIVYVALKSLKIGFLETLKET 222
            :.||||.:...|:|..|:|||:      .|.:.:|:.|::|......|: |..:|.||..|:|..
  Fly   128 KRDHHCIFAATCIGHNNHRYFFWLTFYLAFGIFMSMATLFVDVGRSFYL-LHRMKAGFGNTVKSL 191

Human   223 PGTVLEVLIC-FFTLWSVVGLTGFHTFLVALNQT------TNEDI------------KGSWTG-K 267
            .......||. .|.|.....:..|...::.||.|      .:.|:            :|.||. .
  Fly   192 SYFRYVCLILNIFALGFPALMLRFQVQILKLNSTYYQISSRHHDLGFRNNCQLIMGQRGLWTFIS 256

Human   268 NRVQNPYSHGNI---VKNC 283
            ..:::|..|...   :|.|
  Fly   257 PSLRSPLPHDGTHWKIKQC 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZDHHC9NP_001008223.1 DHHC 138..261 CDD:396215 40/147 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 303..364
CG17196NP_651426.1 zf-DHHC 103..228 CDD:279823 39/125 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.