Sequence 1: | NP_001008223.1 | Gene: | ZDHHC9 / 51114 | HGNCID: | 18475 | Length: | 364 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_651425.2 | Gene: | CG17197 / 43111 | FlyBaseID: | FBgn0039367 | Length: | 290 | Species: | Drosophila melanogaster |
Alignment Length: | 271 | Identity: | 63/271 - (23%) |
---|---|---|---|
Similarity: | 101/271 - (37%) | Gaps: | 106/271 - (39%) |
- Green bases have known domain annotations that are detailed below.
Human 42 LFLILGTCTLFFAFECRYLAVQLSPAIP-VFAAMLFLFSMATLLRTSFSDPGVIPRALPDEAAFI 105
Human 106 EMEI-------EATNGAV---PQGQRPPPRIKNFQINNQIVKLKYCYTCKIFRPPRASHCSICDN 160
Human 161 CVERFDHHCPWVGNCVGKRNYRYFYLFILSLSL-------------------------------- 193
Human 194 ----------LTIYVFAFNIVYVALKSLKIGFLETLKETPGTVLEVLICFFT------LWS---- 238
Human 239 VVGLTGFHTFL 249 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ZDHHC9 | NP_001008223.1 | DHHC | 138..261 | CDD:396215 | 43/164 (26%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 303..364 | ||||
CG17197 | NP_651425.2 | PHA02688 | <9..70 | CDD:222919 | 14/65 (22%) |
zf-DHHC | 100..>198 | CDD:279823 | 24/104 (23%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5273 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |