DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZDHHC9 and CG17198

DIOPT Version :9

Sequence 1:NP_001008223.1 Gene:ZDHHC9 / 51114 HGNCID:18475 Length:364 Species:Homo sapiens
Sequence 2:NP_001287532.1 Gene:CG17198 / 43110 FlyBaseID:FBgn0039366 Length:299 Species:Drosophila melanogaster


Alignment Length:292 Identity:79/292 - (27%)
Similarity:121/292 - (41%) Gaps:69/292 - (23%)


- Green bases have known domain annotations that are detailed below.


Human    46 LGTCTL--FFAFECRYLAVQLSPAIPVFAAMLFLFSMAT-LLRTSFSDPGVIPRALPDEAAFIEM 107
            :..|.:  |:.||..|:       :|.|   |.||..|. .|.|::     |...:.:.......
  Fly    43 INVCIILFFYFFEAFYV-------MPQF---LGLFGQAVHFLVTTW-----IVYNILENLRLCVT 92

Human   108 EIEATNGAVPQGQRPPPRIKNFQINNQIVKLKYCYTCKIFRPPRASHCSICDNCVERFDHHCPWV 172
            .:...:...||.|:|        :..:.....:|..|:...|||:.||:|||.|:.:.||||.:|
  Fly    93 TLNTVDSLPPQMQQP--------MKGEEHLWHFCKICQRNVPPRSWHCNICDACILKRDHHCNFV 149

Human   173 GNCVGKRNYRYFYLFILSLSLLTIYVFAFNIVYVALKSLKIGFLETLKE---------TPGTVLE 228
            |||||..|.|||..|....::.:. |..|:...:|.|. .:||.:.:|.         .||.  :
  Fly   150 GNCVGHNNQRYFIWFSFYAAIGSA-VALFDNFMLAHKH-GVGFFDLVKANYIIFNAYMNPGR--K 210

Human   229 VLICFFTLWSVVGLTGFHT-FLVALNQTTNEDIKGSWTGKNRVQNPYSH-------GNIVKNCCE 285
            .|:.|:.:.||:|:..|.. |..||..|....:.     ||.|.:.||.       ||   |...
  Fly   211 ELVIFYRIVSVLGVNIFAVLFPAALFCTQVVTVI-----KNSVMHDYSDRTYDLGLGN---NLTL 267

Human   286 VL-------CGPLPPSVLDRRGILPLEESGSR 310
            :|       |  |.|::..     ||..:|:|
  Fly   268 ILGSRRLWTC--LSPNIKS-----PLPHNGTR 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZDHHC9NP_001008223.1 DHHC 138..261 CDD:396215 45/132 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 303..364 4/8 (50%)
CG17198NP_001287532.1 zf-DHHC 43..>176 CDD:303066 45/156 (29%)
zf-DHHC 111..252 CDD:279823 48/149 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.