DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZDHHC9 and Hip14

DIOPT Version :9

Sequence 1:NP_001008223.1 Gene:ZDHHC9 / 51114 HGNCID:18475 Length:364 Species:Homo sapiens
Sequence 2:NP_001261910.1 Gene:Hip14 / 39747 FlyBaseID:FBgn0259824 Length:655 Species:Drosophila melanogaster


Alignment Length:281 Identity:79/281 - (28%)
Similarity:126/281 - (44%) Gaps:52/281 - (18%)


- Green bases have known domain annotations that are detailed below.


Human    40 LTLFLILGTCTLFFAFECRYLAVQLSPAIPVFAAMLFLFSMATL----LRTSFSDPGVIPRALPD 100
            |.|.:.|.|...|:.....|    :..|:...|.:.||.|...|    |::...|||:| |...:
  Fly   350 LPLSVYLATKAWFYVTWLMY----IDDAVSFTATVCFLISSLLLWVCFLKSWKGDPGII-RPTRE 409

Human   101 EAAFIEMEIEATNGAVPQGQRPPPRIKNFQINNQIVKLKYCYTCKIFRPPRASHCSICDNCVERF 165
            :.....:|:....|.   |..|               ..:|..|.:.||.|:.|||:||.||.||
  Fly   410 QRFKTIIELSERGGI---GFEP---------------ASFCSGCLVRRPIRSKHCSVCDRCVARF 456

Human   166 DHHCPWVGNCVGKRNYRYFYLFILSLSLLTIY-VFAFNIVYVALKSLKI-GFLETLKET------ 222
            ||||||||||:|.:|:.||..|:..|.::..: ::..:..||...:::. .||..::..      
  Fly   457 DHHCPWVGNCIGLKNHSYFMGFLWMLLIMCAWMLYGGSKYYVNQCNVRFDDFLGAMRAIGNCDAW 521

Human   223 PGTVLEVLICFFTLWSVVGLTGFHTF-LVALNQTTNEDIKGSWTGKNR------VQNPYSHG--- 277
            .|.|:...:...: | |:.||...|: ::.|..||||.:.   .|:.|      ..:|::.|   
  Fly   522 VGWVMGNALLHMS-W-VILLTICQTYQVICLGMTTNERMN---RGRYRHFQAKGGHSPFTRGPIQ 581

Human   278 NIVKNCCEVLC-GPLPPSVLD 297
            |:| :..|..| |.:.|..:|
  Fly   582 NLV-DFLECSCFGLVQPKRVD 601

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZDHHC9NP_001008223.1 DHHC 138..261 CDD:396215 46/131 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 303..364
Hip14NP_001261910.1 ANK 52..165 CDD:238125
Ank_2 52..142 CDD:289560
ANK repeat 77..108 CDD:293786
ANK repeat 110..142 CDD:293786
ANK 114..233 CDD:238125
Ank_2 116..209 CDD:289560
ANK repeat 144..175 CDD:293786
ANK repeat 177..209 CDD:293786
Ank_5 198..251 CDD:290568
ANK repeat 212..244 CDD:293786
zf-DHHC 426..559 CDD:279823 47/149 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.