DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZDHHC9 and app

DIOPT Version :9

Sequence 1:NP_001008223.1 Gene:ZDHHC9 / 51114 HGNCID:18475 Length:364 Species:Homo sapiens
Sequence 2:NP_648561.2 Gene:app / 39399 FlyBaseID:FBgn0260941 Length:755 Species:Drosophila melanogaster


Alignment Length:344 Identity:184/344 - (53%)
Similarity:239/344 - (69%) Gaps:14/344 - (4%)


- Green bases have known domain annotations that are detailed below.


Human     2 SVMVVRKKVTRKWEKLPGRNTFCCDGRVMMARQKGIFYLTLFLILGTCTLFFAFECRYLAVQLSP 66
            |.|...::||||||...|||.|.|||.:|.|...|:||||..||.||..|||||:|.:||..::|
  Fly    10 SNMAPNQRVTRKWELFAGRNKFYCDGLLMSAPHTGVFYLTCILITGTSALFFAFDCPFLADSINP 74

Human    67 AIPVFAAMLFLFSMATLLRTSFSDPGVIPRALPDEAAFIEMEIEATNGAVPQGQRPPPRIKNFQI 131
            |||:..|:|:.|:|::||||:|:||||||||..||||:||.:||..|.......|||||.|...:
  Fly    75 AIPIVGAVLYFFTMSSLLRTTFTDPGVIPRASNDEAAYIEKQIEVPNSLNSPTYRPPPRTKEVLV 139

Human   132 NNQIVKLKYCYTCKIFRPPRASHCSICDNCVERFDHHCPWVGNCVGKRNYRYFYLFILSLSLLTI 196
            ..|.||||||:||||||||||||||:|||||:|||||||||||||||||||:||||::||:.|.:
  Fly   140 KGQTVKLKYCFTCKIFRPPRASHCSLCDNCVDRFDHHCPWVGNCVGKRNYRFFYLFLVSLAFLAV 204

Human   197 YVFAFNIVYVAL---KSLKIGFLETLKETPGTVLEVLICFFTLWSVVGLTGFHTFLVALNQTTNE 258
            ::|:.::.::.|   |..::  ...:|..|.||:.|.||||::|||:||.||||:|...:|||||
  Fly   205 FIFSCSVTHLVLLMKKEHEV--FNVIKAAPFTVIVVFICFFSIWSVIGLAGFHTYLTTSDQTTNE 267

Human   259 DIKGSWTGKN--RVQNPYSHGNIVKNCCEVLCGPLPPSVLDRRGILPLE--ESGSRPPSTQETSS 319
            |:|||::.|.  |.|||||.|||..|||.:||||:.||::|||||...|  :......|.:...|
  Fly   268 DLKGSFSSKGGPRTQNPYSRGNICLNCCHILCGPMTPSLIDRRGIATDEFIQQMQHQSSPRHALS 332

Human   320 SLLPQSPAPTEHLNSNEMP 338
            .:|..|     |:.:...|
  Fly   333 DVLSAS-----HMVTTSQP 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZDHHC9NP_001008223.1 DHHC 138..261 CDD:396215 77/125 (62%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 303..364 7/38 (18%)
appNP_648561.2 zf-DHHC 146..270 CDD:279823 77/125 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 206 1.000 Domainoid score I2911
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1264614at2759
OrthoFinder 1 1.000 - - FOG0000285
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100625
Panther 1 1.100 - - O PTHR22883
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R405
SonicParanoid 1 1.000 - - X394
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
109.810

Return to query results.
Submit another query.