DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZDHHC9 and CG4676

DIOPT Version :9

Sequence 1:NP_001008223.1 Gene:ZDHHC9 / 51114 HGNCID:18475 Length:364 Species:Homo sapiens
Sequence 2:NP_610853.1 Gene:CG4676 / 36465 FlyBaseID:FBgn0033815 Length:284 Species:Drosophila melanogaster


Alignment Length:225 Identity:48/225 - (21%)
Similarity:82/225 - (36%) Gaps:80/225 - (35%)


- Green bases have known domain annotations that are detailed below.


Human    10 VTRKWEKLPGR--NTFCCDGRV-MMARQKGIFYLTL------------FLILGTCTLFFAFECRY 59
            :.|.|:::..|  :.|.|...| :......||::|:            :.:|...:||..|.   
  Fly     3 ILRSWDRVKPRSISDFACFLLVAVFVPVTYIFHVTIVMPELFAIGGIWYTLLWLASLFLIFN--- 64

Human    60 LAVQLSPAIPVFAAMLFLFSMATLLRTSFSDPGVIPRALPDEAAFIEMEIEATNGAVPQGQRPPP 124
                      :.:.||....:.|.:|.....|       |.:||                     
  Fly    65 ----------ITSNMLACMLVDTSIRKELLKP-------PLDAA--------------------- 91

Human   125 RIKNFQINNQIVKLKYCYTCKIFRPPRASHCSICDNCVERFDHHCPWVGNCVGKRNYRYFYLFIL 189
                     |:.:...|..|:...|||:.||.:|:.||.:.||||.:...|:|..|||||:.:  
  Fly    92 ---------QLARWHSCQDCQTLVPPRSWHCEVCNVCVLKRDHHCRFTCCCIGHHNYRYFFYY-- 145

Human   190 SLSLLTIYVFAFNIVYVALKSLKIGFLETL 219
                         :||:.:.||....:|::
  Fly   146 -------------LVYMIIGSLAAAIMESI 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZDHHC9NP_001008223.1 DHHC 138..261 CDD:396215 26/82 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 303..364
CG4676NP_610853.1 zf-DHHC 99..232 CDD:279823 26/79 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.