DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZDHHC9 and CG1407

DIOPT Version :9

Sequence 1:NP_001008223.1 Gene:ZDHHC9 / 51114 HGNCID:18475 Length:364 Species:Homo sapiens
Sequence 2:NP_001286264.1 Gene:CG1407 / 36043 FlyBaseID:FBgn0033474 Length:452 Species:Drosophila melanogaster


Alignment Length:371 Identity:100/371 - (26%)
Similarity:151/371 - (40%) Gaps:73/371 - (19%)


- Green bases have known domain annotations that are detailed below.


Human    42 LFLILGTCTLFFAFECRYLAVQLSPAIPVFAAMLFLFSMATLL-----RTSFSDPGVIPR--ALP 99
            ||:.......::|:............|.:...:||.....||.     ||..:..|.||.  .:|
  Fly    26 LFITAVIAWSYYAYVVELCIRNSENRIGMIFMLLFYHLFLTLFMWSYWRTIMTSVGRIPDQWRIP 90

Human   100 DEAAFIEMEIEATNGAVPQGQRPPPRIKN-----FQINNQIV--KLKYCYTCKIFRPPRASHCSI 157
            ||........::     |..|:   ||.|     ..:.|:.:  .:::|..|||.:|.||.|||:
  Fly    91 DEEVSRLFRADS-----PDTQK---RILNNFARDLPVTNRTMNGSVRFCEKCKIIKPDRAHHCSV 147

Human   158 CDNCVERFDHHCPWVGNCVGKRNYRYFYLFILSLSLLTIYVFAFNIVYVALKSLKIGFLET---- 218
            |..||.:.|||||||.|||...||:||.||:....:..:|| ||..::..::..|:|..:.    
  Fly   148 CSCCVLKMDHHCPWVNNCVNFYNYKYFVLFLGYALVYCLYV-AFTSLHDFVEFWKVGAYDNNGYS 211

Human   219 ----LKETPGTVLEVLICFFT----LWSVVGLTGFHTFLVALNQTTNEDIKGSWTGKNRVQNPYS 275
                |..:......:|..||.    ..|:|.|.|:|.:||.:|:||.|..:....   ||..|..
  Fly   212 AQGQLNASGMGRFHILFLFFIAIMFAISLVSLFGYHIYLVLVNRTTLESFRAPIF---RVGGPDK 273

Human   276 HG-NIVK--NCCEVLCGP-----LPPSVLDRRG---ILPLEESGSRPPSTQET------------ 317
            :| |:.:  |.|||....     ||  |...||   ..|.....||..::..|            
  Fly   274 NGYNLGRYANFCEVFGDDWQYWFLP--VFSSRGDGYSYPTSSDQSRVSTSSPTQRYDAMGDTTTS 336

Human   318 ------SSSLLPQSPAPTEHLNSNEMPED----SSTPEEMPPPEPP 353
                  :..|:..||..|.:.:.|:.|..    |..|.::...:||
  Fly   337 RLDGNPTDKLIGASPLDTTNHHHNQSPHQVRSTSVLPTQLLQIQPP 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZDHHC9NP_001008223.1 DHHC 138..261 CDD:396215 50/134 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 303..364 14/73 (19%)
CG1407NP_001286264.1 zf-DHHC 129..259 CDD:279823 49/130 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157927
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.