DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZDHHC9 and Dnz1

DIOPT Version :9

Sequence 1:NP_001008223.1 Gene:ZDHHC9 / 51114 HGNCID:18475 Length:364 Species:Homo sapiens
Sequence 2:NP_477449.1 Gene:Dnz1 / 34503 FlyBaseID:FBgn0027453 Length:276 Species:Drosophila melanogaster


Alignment Length:260 Identity:71/260 - (27%)
Similarity:116/260 - (44%) Gaps:58/260 - (22%)


- Green bases have known domain annotations that are detailed below.


Human    27 GRVMMARQKGIFYLTLFLILGTCTLFFAFECRYLAVQLSPAIPVFAAMLFLFSMATLLRTSFSDP 91
            |.|:.|....|.::.|..:.|  :|:.:|.           :.:|..::||.:|:. .:..||||
  Fly    18 GAVLYADYVVIRWIILTTMPG--SLWMSFH-----------VVLFNTVVFLLAMSH-SKAVFSDP 68

Human    92 GVIPRALPDEAAFIEMEIEATNGAVPQGQRPPPRIKNFQINNQIVKLKYCYTCKIFRPPRASHCS 156
            |.:|  ||....... ::..||     ...|||.      |....:...|..|:.:|||||.||.
  Fly    69 GTVP--LPANRLDFS-DLHTTN-----KNNPPPG------NGHSSEWTVCTRCETYRPPRAHHCR 119

Human   157 ICDNCVERFDHHCPWVGNCVGKRNYRYFYLFILSLSLLTIYVFAF--------------NIVYVA 207
            ||..|:.|.||||||:.||||:||.:||..|::.::||::|..|.              |::...
  Fly   120 ICKRCIRRMDHHCPWINNCVGERNQKYFLQFLIYVALLSLYSIALIVGSWVWPCEECSQNVIETQ 184

Human   208 LKSLKIGFLETLKETPGTVLEVLICFFTLW-SVVGLTGFHTFLVALNQTTNEDI--KGSWTGKNR 269
            |:.:.           ..:|.::...|.|: :.:.:...|..|  .::|..|.|  ||::....|
  Fly   185 LRMIH-----------SVILMLVSALFGLFVTAIMVDQLHAIL--YDETAVEAIQQKGTYRPNRR 236

Human   270  269
              Fly   237  236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZDHHC9NP_001008223.1 DHHC 138..261 CDD:396215 42/139 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 303..364
Dnz1NP_477449.1 DHHC 97..228 CDD:396215 42/143 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157940
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.