DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ABHD5 and CG5068

DIOPT Version :9

Sequence 1:NP_001342115.1 Gene:ABHD5 / 51099 HGNCID:21396 Length:349 Species:Homo sapiens
Sequence 2:NP_001261609.1 Gene:CG5068 / 39032 FlyBaseID:FBgn0035951 Length:409 Species:Drosophila melanogaster


Alignment Length:375 Identity:63/375 - (16%)
Similarity:115/375 - (30%) Gaps:161/375 - (42%)


- Green bases have known domain annotations that are detailed below.


Human    78 LVLLHGFGGGLGLWA---------LNFGDLCTNRPVYAFDLLGFGRSSRPRFDSDAEEVENQFVE 133
            |:||||.|.....||         ::...||       .|:.|.|       ||..::.::...:
  Fly    74 LLLLHGGGYSALTWAHFCSEVTSMIHCQCLC-------IDMRGHG-------DSKVDDEDDLSAD 124

Human   134 SI-------------EEWRCALGLDKMILLGHNLGGFLAAAYSLKYPSRVNHLILV--------- 176
            ::             ||      :.::.::||::||.:|..::        |:.||         
  Fly   125 TLAKDIGDLILKLYPEE------VPQLFVVGHSMGGAIAVHFA--------HMALVPNLIGITVI 175

Human   177 --------------------EPWGFPERPD--------------------------------LAD 189
                                .|..|...|:                                ||.
  Fly   176 DVVEGTAMEALASMQSFLRSRPKYFQSIPNAIEWCIRSGQVRNVDSAKVSMPGQIINCTTNKLAT 240

Human   190 QDRPIP--VWIRALGAALTPFNPLAGLRIAGPFGLSLVQRLRP-----------------DFKRK 235
            .|.|:|  |...|...::.|          .||.:|..:...|                 |||:.
  Fly   241 NDLPLPDDVLEEAHHNSMFP----------NPFSISEDEESSPPGDDAADGSSESAAAGADFKKP 295

Human   236 YSSMFEDDTVTEYIYHCNVQTP--------SG-ETAFKNMTIPYGWAKRPMLQRIGKMHPDIPVS 291
            .::....:....|.:..::...        || ...|.|:.:|    |:.:|..|..:...:.|.
  Fly   296 NTTKSTTEAAKNYTWRIDLSKSEKYWVGWFSGLSDKFLNLRLP----KQLLLASIDGLDRTLTVG 356

Human   292 VIFGA-RSCIDGNSGTSIQSLRPHSYVKTIAILGAGHYV---YADQPEEF 337
            .:.|. :..:....|.::...|||...:.|    :|:.:   :|:...||
  Fly   357 QMQGRFQMQVLARCGHAVHEDRPHEVAEVI----SGYLIRNRFAEAASEF 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ABHD5NP_001342115.1 Abhydrolase_1 1..345 CDD:331148 63/375 (17%)
HXXXXD motif 327..332 0/7 (0%)
CG5068NP_001261609.1 MhpC 70..>204 CDD:223669 27/157 (17%)
Abhydrolase_5 73..>161 CDD:289465 22/106 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.