DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ABHD5 and CG2059

DIOPT Version :9

Sequence 1:NP_001342115.1 Gene:ABHD5 / 51099 HGNCID:21396 Length:349 Species:Homo sapiens
Sequence 2:NP_001188553.1 Gene:CG2059 / 31663 FlyBaseID:FBgn0029942 Length:308 Species:Drosophila melanogaster


Alignment Length:315 Identity:75/315 - (23%)
Similarity:120/315 - (38%) Gaps:59/315 - (18%)


- Green bases have known domain annotations that are detailed below.


Human    53 EPVRISNGNKIWTLKFSHNISNKTPLVLLHGFGGGLGLWALNFGDLC--TNRPVYAFDLLGFGRS 115
            :||.:|..:  :|   ..|.....||:..||..|....|......|.  .:|.|||.|:...|.|
  Fly    35 DPVELSFDS--YT---GENPETSPPLLTYHGLFGSKQNWRGISKALVRKVSRKVYAIDVRNHGES 94

Human   116 SRPRFDSDAEEVEN--QFVESIEEWRCALGLDKMILLGHNLGGFLAAAYSLKYPSRVNHLILVEP 178
            ......:.....|:  .|:|.......|       .:||::||.....::.|||..|..||:|  
  Fly    95 PHSSVHNSKAMSEDLRLFMEQRSHPNAA-------CMGHSMGGRSMMYFARKYPELVERLIVV-- 150

Human   179 WGFPERPDLADQDRPIPVWIRALGAALTPFNPLAGLRIAGPFGLSLVQRLRPDFKRKYSSMFEDD 243
                   |::    ||.| .|:.|.....|:.:..|.::....:|..:::.   :.|.....||:
  Fly   151 -------DIS----PISV-PRSTGEMTEIFDAMVSLDLSPSMSMSEGRKIA---REKLLKATEDE 200

Human   244 TVTEYIYHCNVQTPSGETAFKNMTIPYGWA-----KRPMLQRIGKMHPDI--------PVSVIFG 295
            ||...:.:......:|         .:.||     .|..|.|..|...::        |.:.|.|
  Fly   201 TVDFIMLNLRKNPDTG---------AFSWACNAHVLREFLTRFDKYQSNLEELPPYTGPTTFICG 256

Human   296 ARS-CIDGNSGTSIQSLRPHSYVKTIAILGAGHYVYADQPEEFNQKVKEICDTVD 349
            .|| .:.......||.:.|:|   .|..|.|||.|:.::|:||...|.|..:..:
  Fly   257 TRSPYMRREQWPQIQKMFPNS---EIHWLDAGHLVHFEKPQEFLTIVSEFLNRTE 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ABHD5NP_001342115.1 Abhydrolase_1 1..345 CDD:331148 75/309 (24%)
HXXXXD motif 327..332 2/4 (50%)
CG2059NP_001188553.1 PRK10673 38..305 CDD:182637 73/307 (24%)
Abhydrolase_5 54..>151 CDD:289465 29/112 (26%)
Abhydrolase <253..287 CDD:304388 12/36 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.