DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment YBX2 and CG9705

DIOPT Version :10

Sequence 1:XP_016880202.1 Gene:YBX2 / 51087 HGNCID:17948 Length:379 Species:Homo sapiens
Sequence 2:NP_648920.1 Gene:CG9705 / 39875 FlyBaseID:FBgn0036661 Length:143 Species:Drosophila melanogaster


Alignment Length:80 Identity:23/80 - (28%)
Similarity:31/80 - (38%) Gaps:15/80 - (18%)


- Green bases have known domain annotations that are detailed below.


Human    58 PSAPGSRTPGNPATAVSGTPAPPARSQADKPVL------------AIQ---VLGTVKWFNVRNGY 107
            |..|.......|......:.:|.|..|...|::            |::   |.|.||.|:...|:
  Fly     4 PRTPEKLLAAKPPVLHHNSHSPNASLQLPSPIITRRTRTASTSARALENPVVTGMVKSFSRTKGH 68

Human   108 GFINRNDTKEDVFVH 122
            |||..|...||||.|
  Fly    69 GFITPNAGGEDVFCH 83

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
YBX2XP_016880202.1 CSD 94..178 CDD:278729 15/29 (52%)
PRK12323 <319..>367 CDD:481241
CG9705NP_648920.1 CSP_CDS 55..120 CDD:239905 15/29 (52%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.