DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FCF1 and CG17652

DIOPT Version :10

Sequence 1:NP_057046.1 Gene:FCF1 / 51077 HGNCID:20220 Length:198 Species:Homo sapiens
Sequence 2:NP_608617.1 Gene:CG17652 / 33353 FlyBaseID:FBgn0031361 Length:244 Species:Drosophila melanogaster


Alignment Length:133 Identity:42/133 - (31%)
Similarity:70/133 - (52%) Gaps:9/133 - (6%)


- Green bases have known domain annotations that are detailed below.


Human    51 HPSCLFFQYNTQLGPPYHILVDTNFINFSIKAKLDLVQSMMDCLYAKC-IPCI-TDCVMAEIEKL 113
            |.:.:||..|.....||.:|:|..|...:::.|:.:.:.:..  |.:| :..: |.||:.|.|.|
  Fly    10 HKTLVFFASNFDYREPYQVLIDATFCQAALQQKIGIDEQIKK--YFQCGVKLLTTQCVILESESL 72

Human   114 GQKYRVALRIAKDPRFERLPCTHKG--TYADDCLVQRVTQHKCYIVATVDRDLKRRIRKIPGVPI 176
            |.....|..|.|  ||....|.|:|  ..|.:| ::.:|:...|:||:.||.|:..:|||||..:
  Fly    73 GAPLTGATSIVK--RFHVHKCGHEGKPVPASEC-IKSMTKDNRYVVASQDRLLQESLRKIPGRCL 134

Human   177 MYI 179
            :|:
  Fly   135 LYL 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FCF1NP_057046.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 22..47
PIN_Fcf1-like 57..187 CDD:350212 40/127 (31%)
CG17652NP_608617.1 PIN_Fcf1-Utp23-H 19..145 CDD:350214 39/124 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.