DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MRPL4 and mRpL4

DIOPT Version :9

Sequence 1:XP_011526347.1 Gene:MRPL4 / 51073 HGNCID:14276 Length:357 Species:Homo sapiens
Sequence 2:NP_524939.1 Gene:mRpL4 / 49425 FlyBaseID:FBgn0001995 Length:296 Species:Drosophila melanogaster


Alignment Length:253 Identity:118/253 - (46%)
Similarity:159/253 - (62%) Gaps:16/253 - (6%)


- Green bases have known domain annotations that are detailed below.


Human    16 TGSQGLSSLAEEAARATEN----PEQVASEGLPEPVLRKVELP------VPTHRRPV-QAWVESL 69
            |..|.|..:|...:|:..:    .|..|:.|.|......:.||      :|..|... |||:|:.
  Fly     8 TSRQVLYPVARTFSRSGNHGNVVTEAAATVGAPPATRSPLILPQDYTDCLPVSRNTARQAWIENT 72

Human    70 RGFEQERVGLADLHPDVFATAPRLDILHQVAMWQKNFKRISYAKTKTRAEVRGGGRKPWPQKGTG 134
            ....:.:|||.:|||||||..||:||:.:...||..::.:|.|.|||||||||||||||||||.|
  Fly    73 DAVAERKVGLIELHPDVFAAQPRVDIIQENVEWQSKYRYVSMAHTKTRAEVRGGGRKPWPQKGGG 137

Human   135 RARHGSIRSPLWRGGGVAHGPRGPTSYYYMLPMKVRALGLKVALTVKLAQDDLHIMDSLELPTGD 199
            ||||||:|||:.:||||.||||.||:::||||...|.|||...|:||||||||||:|::::||||
  Fly   138 RARHGSLRSPMLKGGGVVHGPRSPTTHFYMLPFYKRVLGLTSTLSVKLAQDDLHIIDNVDIPTGD 202

Human   200 PQYLTELAHYRRWGDSVLLVDLTHEEMPQSIVEATSRLKTFNLIPA----VATRWRHE 253
            .::|.:|...|.||.|||:||..| ..|.:|.:|:..|...||:|.    |.:..:|:
  Fly   203 AEFLKDLIAERNWGPSVLIVDEDH-MFPANICQASDDLGYVNLMPTFGLNVYSMLKHD 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MRPL4XP_011526347.1 Ribosomal_L4 81..245 CDD:278970 95/163 (58%)
mRpL4NP_524939.1 Ribosomal_L4 83..274 CDD:278970 98/178 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158063
Domainoid 1 1.000 236 1.000 Domainoid score I2365
eggNOG 1 0.900 - - E1_COG0088
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H32286
Inparanoid 1 1.050 261 1.000 Inparanoid score I3112
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52318
OrthoDB 1 1.010 - - D1592747at2759
OrthoFinder 1 1.000 - - FOG0003002
OrthoInspector 1 1.000 - - oto89851
orthoMCL 1 0.900 - - OOG6_101056
Panther 1 1.100 - - LDO PTHR10746
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1141
SonicParanoid 1 1.000 - - X3343
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.