DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MRPS18C and mRpS18B

DIOPT Version :10

Sequence 1:NP_057151.1 Gene:MRPS18C / 51023 HGNCID:16633 Length:142 Species:Homo sapiens
Sequence 2:NP_523606.1 Gene:mRpS18B / 35299 FlyBaseID:FBgn0032849 Length:204 Species:Drosophila melanogaster


Alignment Length:94 Identity:31/94 - (32%)
Similarity:47/94 - (50%) Gaps:18/94 - (19%)


- Green bases have known domain annotations that are detailed below.


Human    37 RRGCSQQVSSNEDLPISMENPYKEPLKKCILCGKH---VDYKNVQLLSQFVSPFTGCIYGRHITG 98
            |:.|.:|   |.   ||..||       |.:|...   :||:|.:||.||:||.:|.:.....||
  Fly   108 RKTCIRQ---NR---ISTGNP-------CPICRDEYLVLDYRNTELLEQFISPHSGDVLSYSKTG 159

Human    99 LCGKKQKEITKAIKRAQIMGFMPVTYKDP 127
            ||.|....:..|:::|:..|::  ||..|
  Fly   160 LCQKSHLRLMVAVQQARDSGYL--TYDVP 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MRPS18CNP_057151.1 Ribosomal_S18 70..120 CDD:460054 18/52 (35%)
mRpS18BNP_523606.1 Ribosomal_S18 131..181 CDD:460054 18/49 (37%)

Return to query results.
Submit another query.