DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ASCC1 and UFD4

DIOPT Version :9

Sequence 1:NP_001185728.1 Gene:ASCC1 / 51008 HGNCID:24268 Length:400 Species:Homo sapiens
Sequence 2:NP_012915.3 Gene:UFD4 / 853859 SGDID:S000001493 Length:1483 Species:Saccharomyces cerevisiae


Alignment Length:269 Identity:55/269 - (20%)
Similarity:98/269 - (36%) Gaps:88/269 - (32%)


- Green bases have known domain annotations that are detailed below.


Human    58 GFRSTLRAPSLLYNLIHLNTSNDCGFQKI------TLDCQNIYTWKS------------------ 98
            |:..|..|.|||.|.|     .|..|.|:      .:...|:.|..|                  
Yeast  1205 GYLGTFVARSLLDNRI-----LDFRFSKVFFELLHRMSTPNVTTVPSDVETCLLMIELVDPLLAK 1264

Human    99 --RHIVGKRGDTRKKIEMETKTSISIPKPGQDGEIVITG------------QHRNGVI------S 143
              ::||..:.|   .:.:|: .|::...||.|...:|.|            ::.:|||      .
Yeast  1265 SLKYIVANKDD---NMTLES-LSLTFTVPGNDDIELIPGGCNKSLNSSNVEEYIHGVIDQILGKG 1325

Human   144 ARTRIDVLLDTFRRKQPFTHFLAFFLNE-VEVQEGFLRFQEE-----VLAKCSMDHG--VDSSIF 200
            ...::...::.|.:...:...|..|.:| |::   |.|.:|:     :....:.:||  :|||| 
Yeast  1326 IEKQLKAFIEGFSKVFSYERMLILFPDELVDI---FGRVEEDWSMATLYTNLNAEHGYTMDSSI- 1386

Human   201 QNPKKLHLTIGMLVLLSEEEIQQTCEMLQQCKEEFINDISGGKPLEVEMAGIEYMNDDPGMVDVL 265
                 :|..|.::....:.|           :..|:..::|...|.:  .|.:.:|  |....||
Yeast  1387 -----IHDFISIISAFGKHE-----------RRLFLQFLTGSPKLPI--GGFKSLN--PKFTVVL 1431

Human   266 YAKVHMKDG 274
               .|.:||
Yeast  1432 ---KHAEDG 1437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ASCC1NP_001185728.1 Required for interaction with ASCC3. /evidence=ECO:0000269|PubMed:29997253 1..53
vigilin_like_KH 99..148 CDD:239087 13/66 (20%)
PLN00108 157..370 CDD:177724 27/126 (21%)
AKAP7_NLS 161..349 CDD:287446 27/122 (22%)
UFD4NP_012915.3 HUL4 581..1482 CDD:227354 55/269 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.