DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ASCC1 and HUL5

DIOPT Version :9

Sequence 1:NP_001185728.1 Gene:ASCC1 / 51008 HGNCID:24268 Length:400 Species:Homo sapiens
Sequence 2:NP_011374.1 Gene:HUL5 / 852736 SGDID:S000003109 Length:910 Species:Saccharomyces cerevisiae


Alignment Length:330 Identity:74/330 - (22%)
Similarity:108/330 - (32%) Gaps:151/330 - (45%)


- Green bases have known domain annotations that are detailed below.


Human   151 LLDTFRRKQPFTHFLAF-------------FLNEVEVQEGFLRFQEEVLAKCSMDHGVDSSIFQN 202
            ||.....:....|||:.             |||        |||.||:            ..:::
Yeast   409 LLSKVYERDSRLHFLSTENNPTYWENSEKQFLN--------LRFYEEL------------QEYED 453

Human   203 PKKLHLTIGMLVLLSEEEIQQTCE---------------MLQQCKEEFINDISGGKPLEV----- 247
            ..:.||         |||..:..|               :|.:.|:...:.:...| ||:     
Yeast   454 LYREHL---------EEESDEDMEKEIDLDKERPPLKSLLLNKMKKRLKSSLRFRK-LEILLELP 508

Human   248 ------EMAGIEYM-----------NDDPGMVDVL--YAKVHMKDGSNRLQELVDRVL------- 286
                  |...:.||           :||..::::.  :|...|:..|..:..  |.||       
Yeast   509 FFIPFEERVDLFYMFIALDKKRLSLDDDHNLINMFTPWASTGMRKQSAIISR--DNVLEDAFNAF 571

Human   287 ----ERFQAS-----------------GLIVKEWNSVKLHATVMNTLFRKDPNAE-----GRYNL 325
                |||:||                 |.|.||:.:     ||.:..| |||..|     .||.|
Yeast   572 NSIGERFKASLDVTFINEFGEEAGIDGGGITKEFLT-----TVSDEGF-KDPKHELFRTNDRYEL 630

Human   326 Y------TAEGKYIFKERESFDGRNILK----------SFA---LLPRLEY-NDAISAHCNLCLP 370
            |      ..:.|||:     |.|:.:.|          |||   |...|.| |..:|:..:|   
Yeast   631 YPSVVYDATKLKYIW-----FLGKVVGKCLYEHVLIDVSFADFFLKKLLNYSNGFLSSFSDL--- 687

Human   371 GSSDS 375
            ||.||
Yeast   688 GSYDS 692

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ASCC1NP_001185728.1 Required for interaction with ASCC3. /evidence=ECO:0000269|PubMed:29997253 1..53
vigilin_like_KH 99..148 CDD:239087
PLN00108 157..370 CDD:177724 68/317 (21%)
AKAP7_NLS 161..349 CDD:287446 59/288 (20%)
HUL5NP_011374.1 HUL4 35..910 CDD:227354 74/330 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.