DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ASCC1 and ascc1

DIOPT Version :9

Sequence 1:NP_001185728.1 Gene:ASCC1 / 51008 HGNCID:24268 Length:400 Species:Homo sapiens
Sequence 2:NP_001096371.1 Gene:ascc1 / 100124965 XenbaseID:XB-GENE-987795 Length:355 Species:Xenopus tropicalis


Alignment Length:349 Identity:206/349 - (59%)
Similarity:266/349 - (76%) Gaps:30/349 - (8%)


- Green bases have known domain annotations that are detailed below.


Human     1 MEVLRPQLIRIDGRNYRKNPVQEQTYQHEEDEEDFYQGSMECADEPCDAYEVEQTPQGFRSTLRA 65
            ||||||.||.|.||.||||.|:|.::|:||||||||:.|::|.|||||.:.||:|.:||:.|:..
 Frog     1 MEVLRPTLINIGGRIYRKNAVREASHQNEEDEEDFYRESVQCLDEPCDDFTVEETEKGFQCTIDL 65

Human    66 PSLLYNLIHLNTSNDCGFQKITLDCQNIYTWKSRHIVGKRGDTRKKIEMETKTSISIPKPGQDGE 130
            ||.|:                            ::|:||:|:|::.:|.||:|||.||:||.:|:
 Frog    66 PSQLF----------------------------KYIIGKKGETKRNLESETRTSIIIPRPGVEGD 102

Human   131 IVITGQHRNGVISARTRIDVLLDTFRRKQPFTHFLAFFLNEVEVQEGFLRFQEEVLAKCSMDHGV 195
            |:||||.|||||||||||::|.::|||||||||||:|.||..|:||..|.|:||||||||.|.||
 Frog   103 IIITGQQRNGVISARTRIELLAESFRRKQPFTHFLSFALNHPEIQEKVLLFKEEVLAKCSKDRGV 167

Human   196 DSSIFQNPKKLHLTIGMLVLLSEEEIQQTCEMLQQCKEEFINDISGGKPLEVEMAGIEYMNDDPG 260
            :|||||||.|||||||.:|||||:|:.|..|:||:|||||::.|:|||.|::::.|||||||||.
 Frog   168 ESSIFQNPAKLHLTIGTMVLLSEKEVMQANEILQKCKEEFLDKITGGKSLQLQVVGIEYMNDDPA 232

Human   261 MVDVLYAKVHMKDGSNRLQELVDRVLERFQASGLIVKEWNSVKLHATVMNTLFRKDPNAEGRYNL 325
            |||||||||.|||||.|||.:.||:::||.:|||::|||:.|||||||||||||:||.||.|.::
 Frog   233 MVDVLYAKVEMKDGSERLQLIADRLMQRFVSSGLMLKEWDRVKLHATVMNTLFRRDPLAEERSSI 297

Human   326 YTAEGKYIFKERESFDGRNILKSF 349
              :.||...:||||||.||:||.|
 Frog   298 --SAGKPGQRERESFDARNVLKIF 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ASCC1NP_001185728.1 Required for interaction with ASCC3. /evidence=ECO:0000269|PubMed:29997253 1..53 33/51 (65%)
vigilin_like_KH 99..148 CDD:239087 30/48 (63%)
PLN00108 157..370 CDD:177724 129/193 (67%)
AKAP7_NLS 161..349 CDD:287446 124/187 (66%)
ascc1NP_001096371.1 vigilin_like_KH 62..121 CDD:239087 35/86 (41%)
AKAP7_NLS 133..354 CDD:371071 125/189 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 252 1.000 Domainoid score I11762
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H41079
Inparanoid 1 1.050 411 1.000 Inparanoid score I8939
NCBI 1 1.000 - -
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D206094at32523
OrthoFinder 1 1.000 - - FOG0005022
OrthoInspector 1 1.000 - - oto151245
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6146
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.060

Return to query results.
Submit another query.