DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACOX1 and Arc42

DIOPT Version :9

Sequence 1:NP_004026.2 Gene:ACOX1 / 51 HGNCID:119 Length:660 Species:Homo sapiens
Sequence 2:NP_650840.1 Gene:Arc42 / 42364 FlyBaseID:FBgn0038742 Length:405 Species:Drosophila melanogaster


Alignment Length:388 Identity:87/388 - (22%)
Similarity:147/388 - (37%) Gaps:67/388 - (17%)


- Green bases have known domain annotations that are detailed below.


Human    71 VKKMREFG---IADPDEI----MWFKNF------VHRGRPEP---LDLHLGMFLPTLLHQATAEQ 119
            :::|.|.|   :|.|:|:    :.:..:      :.||....   :.::..::|..||......|
  Fly    64 IRQMGELGVMAVAIPEELGGTGLDYVAYAIAMEEISRGCASAGVIMSVNNSLYLGPLLSFGNDAQ 128

Human   120 QERFFMPAWNLEIIGTYAQTEMGHGTHLRGLETTATYDPETQEFILNSPTVTSIKWWPGGLGKTS 184
            ::.:..|....|.:|.:|.:|.|:|:......|.||  .:...|:||....    |.....  .:
  Fly   129 KKDYITPFTTGERVGCFALSEPGNGSDAGAASTIAT--DKGDHFVLNGTKA----WITNAF--EA 185

Human   185 NHAIVLAQLITKGKCYGLHAFIVPIREIGTHKPLPGITVGDIGPKFGYDEIDNGYLKMDNHRIPR 249
            ..|||.|....:.|..|:.|||||       |...|.::|....|.|........|..::..:|:
  Fly   186 EAAIVFATTNKQLKHKGISAFIVP-------KATKGFSLGKKEDKLGIRGSSTCQLIFEDCVVPK 243

Human   250 ENMLMKYAQVKPDGTYVKPLSNKLTYGTMVFVRSFLVGEAARALSKACTIAIRYSAVRHQSEIKP 314
            ||||     .:|...:      |:...|:...|..:.|:|......|..:|:.| |.:.|:..||
  Fly   244 ENML-----GEPGFGF------KIAMQTLDAGRIGIAGQALGIGQAALELAVDY-AQKRQAFGKP 296

Human   315 GEPEPQILDFQTQQYKLFPL---LATAYAFQFVGAYMKETYHRINEGIGQGDLSELPELHALTAG 376
                  |...|:.|.|:..:   :.:|....:..|::|             |..:.....|..|.
  Fly   297 ------IAKLQSIQQKIADMSLAMESARLLTWRAAWLK-------------DQKQPYTKEAAMAK 342

Human   377 LKAFTSWTANTGIEACRMACGGHGYSHCSGLPNIYVNFTPSCTFEGENTVMMLQTARFLMKSY 439
            |.|  |..|......|....||.||.........|.:...:..:||.:.:..|..|..::|.|
  Fly   343 LAA--SEAATLCSHQCIQILGGMGYVTDMAAERHYRDARITEIYEGTSEIQRLVIAGSILKEY 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACOX1NP_004026.2 AXO 3..637 CDD:173839 87/388 (22%)
PLN02443 5..651 CDD:178062 87/388 (22%)
Arc42NP_650840.1 CaiA 27..405 CDD:224871 87/388 (22%)
SCAD_SBCAD 29..401 CDD:173847 85/384 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.