DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACOX1 and CG4860

DIOPT Version :9

Sequence 1:NP_004026.2 Gene:ACOX1 / 51 HGNCID:119 Length:660 Species:Homo sapiens
Sequence 2:NP_650163.2 Gene:CG4860 / 41480 FlyBaseID:FBgn0037999 Length:415 Species:Drosophila melanogaster


Alignment Length:418 Identity:86/418 - (20%)
Similarity:158/418 - (37%) Gaps:70/418 - (16%)


- Green bases have known domain annotations that are detailed below.


Human    34 REIENMILNDPDFQHEDLNFLTRSQRYEVAVRKSAIMVKKMREFGIADPDEIMWFKNF------V 92
            ||..|..| .|..:|.|...|..:::.........:.|....|:|.:..|    ::.:      |
  Fly    49 REFANAEL-APKARHHDREELYPAEQVRRLGELGLMSVTVREEYGGSGLD----YQAYAIGMEEV 108

Human    93 HRGRPEPLDLHLG---MFLPTLLHQATAEQQERFFMPAWNLEIIGTYAQTEMGHGTHLRGLETTA 154
            .|| ...:.:.:|   ::|..:....|.:|::.|.:|....|.|..||.:|.|:|:......|||
  Fly   109 ARG-DAAVSIVMGVNNLYLGAVQQHGTEQQKQDFLVPYTQGEHIAFYALSEPGNGSDAGAASTTA 172

Human   155 TYDPETQEFILNSPTVTSIKWWPGGLGKTSNHAIVLAQLITKGKCYGLHAFIVPIREIGTHKPLP 219
            ....::.:       :...|.|... .|.::..||.|.:....|..|:.||:.|       |.:|
  Fly   173 KLQGDSYQ-------INGTKAWISN-SKEASGGIVFATVDKSMKHKGITAFLTP-------KDVP 222

Human   220 GITVGDIGPKFGYDEIDNGYLKMDNHRIPRENMLMKYAQVKPDGTYVKPLSNKLTYGTMVFVRSF 284
            |:::.....|.|........|.:::..:||..:|    ....||.       |:...::...|..
  Fly   223 GLSIAKKESKMGMRATSTCQLVLEDVHVPRSRVL----GAAGDGF-------KIAMQSLDCGRIG 276

Human   285 LVGEAARALSKACTIAIRYSAVRHQSEIKPGEPEPQILDFQTQQYKLFPLLATAYAFQFV---GA 346
            :..:|......|..:|:.||    |..:..|:   .:...|..|.||..:.......:.:   .|
  Fly   277 IAAQATGIAQAALELAVDYS----QKRVAFGK---HLARLQLIQQKLADMATRVEISRLLTWRAA 334

Human   347 YMKETYHRINEGIGQGDLSELPELHALTAGLKAFTSWTANTGIEACRMACGGHGYSHCSGLPN-- 409
            ::|:      .|:.....:.:.:|||         |.:|......|....||.||:  :.||.  
  Fly   335 WLKD------NGLPITKEAAMAKLHA---------SESATFCAHQCIQILGGMGYT--TDLPAEL 382

Human   410 IYVNFTPSCTFEGENTVMMLQTARFLMK 437
            .|.|...:..:||.:.:..:..|..:::
  Fly   383 YYRNARVTEIYEGTSEIQRIVIANAVLR 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACOX1NP_004026.2 AXO 3..637 CDD:173839 86/418 (21%)
PLN02443 5..651 CDD:178062 86/418 (21%)
CG4860NP_650163.2 CaiA 37..414 CDD:224871 86/418 (21%)
SCAD_SBCAD 39..410 CDD:173847 86/416 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.