DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACOX1 and Mcad

DIOPT Version :9

Sequence 1:NP_004026.2 Gene:ACOX1 / 51 HGNCID:119 Length:660 Species:Homo sapiens
Sequence 2:NP_648149.1 Gene:Mcad / 38864 FlyBaseID:FBgn0035811 Length:419 Species:Drosophila melanogaster


Alignment Length:479 Identity:104/479 - (21%)
Similarity:170/479 - (35%) Gaps:158/479 - (32%)


- Green bases have known domain annotations that are detailed below.


Human    19 LTHILDGSPEKTRRRREIENMILNDPDFQHEDL-NFLTRSQRYEVAVR--KSA----IMVKKMRE 76
            ::|:   ||..|       :..|.:...|.::| ...||.:...||.:  ||.    .::||..|
  Fly    25 VSHV---SPNGT-------SFALTEDQLQLQELARKFTREEIIPVAAQYDKSGEYPWPIIKKAWE 79

Human    77 FGIADPDEIMWFKNFVHRGRPEPLD---LHLGMFLPTLLHQATA--------------------- 117
            .|:        ..|.:      |.|   |.|.:|...|..:..|                     
  Fly    80 LGL--------MNNHI------PADIGGLDLDVFTTCLSAEELAYGCTGIMTALEASGLGQTPVI 130

Human   118 -----EQQERFFMPAWNLEIIGTYAQTEMGHGTHLRGLETTATYDPETQEFILNSPTVTSIKWW- 176
                 ||::::........::..|..||.|.|:.:.|::|.|  :.:..|:::|..     |.| 
  Fly   131 LSGNKEQKKKYLGRLLEEPLVAAYCVTEPGAGSDVSGIKTRA--EKKGDEWVINGQ-----KMWI 188

Human   177 -PGGLGKTSNHAIVLAQLITKGKCYGLHAFIVPIREIGTHKPLPGITVGDIGPKFGYDEIDNGYL 240
             .||:   :|...|||:.....||....||...|.|    :..||:|.|......|....|...:
  Fly   189 TNGGV---ANWYFVLARTNPDPKCPPSKAFTGFIVE----RDSPGLTPGRKELNMGQRASDTRGI 246

Human   241 KMDNHRIPRENMLM------KYAQVKPDGTYVKPLSNKLTYGTMVFVRSFLVGEAARALSKACTI 299
            ..::.|:|:||:|:      |.|.    ||:.|         |...|.:..||.|.|.|.:    
  Fly   247 TFEDVRVPKENVLIGEGAGFKIAM----GTFDK---------TRPPVAAGAVGLAQRCLDE---- 294

Human   300 AIRYSAVRHQSEIKPGEPEPQILDFQTQQYKLFPL-LATAYAFQFVGAYMK---ETYH------- 353
            |::|:..|                      |.|.: :|...|.||:.|.|.   ||..       
  Fly   295 ALKYALER----------------------KTFGVPIAYHQAVQFMLADMAIGVETSRLAWRLSA 337

Human   354 -RINEGIGQGDLSELPELHALTAGLKAFTSWTANTGIEACRMACGGHGYSHCSGLP--------N 409
             .|::|......:.:.:.||.....|     .|:..::    ..||:|::  |..|        .
  Fly   338 WEIDQGRRNSYYASIAKCHAADMANK-----IASDAVQ----IFGGNGFN--SEYPVEKLMRDAK 391

Human   410 IYVNFTPSCTFEGENTVMMLQTAR 433
            ||.      .:||.:.:..|..:|
  Fly   392 IYQ------IYEGTSQIQRLIISR 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACOX1NP_004026.2 AXO 3..637 CDD:173839 104/479 (22%)
PLN02443 5..651 CDD:178062 104/479 (22%)
McadNP_648149.1 CaiA 35..411 CDD:224871 100/459 (22%)
MCAD 37..414 CDD:173846 100/457 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.